Recombinant Danio rerio Cytochrome b reductase 1 (cybrd1)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics of Recombinant Danio rerio Cytochrome b Reductase 1 (cybrd1)

Recombinant Danio rerio cytochrome b reductase 1 (cybrd1) is a synthetic protein derived from zebrafish, engineered for high-yield production in Escherichia coli. It belongs to the cytochrome b(561) family, which includes iron-regulated proteins with ferric reductase activity critical for iron absorption . Key attributes include:

ParameterValue
UniProt IDQ503V1
Protein LengthFull-length (1-253 amino acids)
Molecular Mass~28.7 kDa (calculated)
TagN-terminal His-tag
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
FunctionFerric (Fe³⁺) reductase; reduces Fe³⁺ to Fe²⁺ using ascorbate as electron donor

Sequence:
MENYPQFLLFFILASVVGIVSIAVALSWVLHYREGLGWDGGAAEFNWHPLLMVIGFIFLQ... (Full sequence available in ).

2.1. Protein Structure

The zebrafish cybrd1 shares structural homology with human Dcytb (duodenal cytochrome b), featuring:

  • Two heme groups coordinated by conserved histidines (His50, His86, His120, His159) .

  • Transmembrane domains facilitating localization to plasma membranes .

  • N-terminal His-tag for purification via nickel-affinity chromatography .

2.2. Redox Activity

  • Ferric reduction: Converts Fe³⁺ to Fe²⁺ in the presence of ascorbate, enabling dietary iron absorption .

  • Midpoint potential: ~+80 mV (similar to human Dcytb) .

  • Electron donors: Ascorbate or dithionite drive reduction .

3.1. Expression Systems

SystemYieldHeme IncorporationKey Challenges
E. coliHigh (mg scale)Requires heme supplementationSolubility issues in some constructs
Insect Sf9 cellsModerateNative heme bindingLower throughput compared to E. coli

Optimization:

  • Heme supplementation: Critical for proper folding in bacterial systems .

  • Tagging: His-tag enhances purification efficiency but may alter membrane localization .

3.2. Purification and Handling

StepMethodNote
LysisSonication or enzymatic lysisPreserve membrane integrity for activity
ChromatographyNickel-affinity (His-tag)High-purity (>90%)
Storage-20°C/-80°C in Tris/PBS bufferAvoid repeated freeze-thaw cycles

4.1. Functional Studies

  • Iron metabolism: Models dietary iron absorption mechanisms in zebrafish .

  • Enzyme kinetics: Redox assays using ascorbate or dithionite to measure Fe³⁺ reduction rates .

4.2. Detection and Analysis

MethodReagentsApplication
SDS-PAGECoomassie stainingPurity validation
ELISAAnti-cybrd1 antibodies (e.g., 26735-1-AP) Quantification in lysates or recombinant samples
Western BlotGoat polyclonal antibody (ab28758) Detection in zebrafish or heterologous systems

5.1. Key Discoveries

  1. Heme dependency: Mutations in conserved histidines (e.g., His50 → Ala) abolish heme binding and activity .

  2. Ascorbate dependency: Reduction efficiency is 67% of dithionite-driven reduction, confirming physiological relevance .

  3. Species conservation: Zebrafish cybrd1 aligns with human Dcytb in heme coordination and function .

5.2. Challenges

  • Solubility: Recombinant cybrd1 may form inclusion bodies in E. coli, requiring denaturation/renaturation .

  • Heme biosynthesis: E. coli lacks endogenous heme, necessitating supplementation or co-expression with heme-synthetic genes .

Comparative Analysis with Human and Other Orthologs

SpeciesExpression SystemTagKey Difference
Danio rerioE. coliHis-tagShorter sequence (253 vs. 286 aa in human)
Homo sapiensInsect Sf9 cellsNoneHigher midpoint potential (+80 mV)
Mus musculusE. coliHis/Fc-Avi-tagModified for antibody conjugation

Antibodies and Detection Tools

AntibodyHostReactivityApplications
26735-1-AP (Proteintech) RabbitHuman, mouse, pigWB, IHC, ELISA
ab28758 (Abcam) GoatHumanIHC (duodenal tissue)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cybrd1; zgc:110065; Plasma membrane ascorbate-dependent reductase CYBRD1; Cytochrome b reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cybrd1
Target Protein Sequence
MENYPQFLLFFILASVVGIVSIAVALSWVLHYREGLGWDGGAAEFNWHPLLMVIGFIFLQ GIAIVVYRLPWTWRCSKQMMKLIHAGLHILAFILAVISVVAVFVFHNAKNIPNMYSLHSW VGLAAVVLYPSQIVLGIAVYLIPVTPVRVRAALMPLHIYSGLFIFISVIAAALMGITEKL IFSLKSPAYKDSPPEAVLVNVLGLLIAAFGALVVWIATRSAWKRPREETAQTLSNNTTSP EEIKVGTDMTTTS
Uniprot No.

Target Background

Function
Plasma membrane reductase that utilizes cytoplasmic ascorbate as an electron donor to reduce extracellular Fe(3+) into Fe(2+). It is also capable of reducing extracellular monodehydro-L-ascorbate and may participate in extracellular ascorbate regeneration. Additionally, it may function as a cupric transmembrane reductase.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.

Q&A

What are the structural characteristics of recombinant Danio rerio cybrd1?

While direct structural data on zebrafish cybrd1 is limited, insights can be drawn from related reductases. Like other ferric reductases, it likely contains transmembrane domains, cytoplasmic FAD-binding regions, and substrate-binding sites optimized for iron compounds. Zebrafish cytochrome b5 reductase, a related enzyme, has been studied for its redox potential (approximately -252 mV), which influences its electron transfer capabilities . Similar methodologies using sodium dithionite as reductant and indigo tetrasulfonate (Em = -46 mV) as mediator could be applied to characterize cybrd1's redox properties.

What is the evolutionary significance of cybrd1 in vertebrates?

Cytochrome reductase systems show remarkable evolutionary conservation across vertebrates. Research on the zebrafish cytochrome b5/cytochrome b5 reductase system indicates that the fundamental electron transfer mechanisms predate the evolution of hemoglobin and myoglobin reductases . This suggests that cybrd1 may represent an ancient component of iron metabolism that has been conserved due to its essential role. The zebrafish model provides a valuable system for studying this evolutionary conservation, as demonstrated by studies showing that "these observations suggest a conserved role of CYB5/CYB5R supporting Cygb function that possibly predates its role as hemoglobin and myoglobin reductases" .

What expression systems are most effective for producing active recombinant zebrafish cybrd1?

For membrane-bound proteins like cybrd1, several expression systems warrant consideration:

  • E. coli systems with specialized tags (such as MBP or SUMO) to enhance solubility

  • Insect cell systems (Sf9 or High Five) which better support membrane protein folding

  • Yeast expression systems (P. pastoris) which can provide high yields of membrane proteins

Based on methodologies used for related reductases, optimization should focus on maintaining enzyme activity. Expression conditions should be carefully controlled, as membrane protein expression often requires lower induction temperatures (16-20°C) and specialized detergents for extraction and purification.

What purification strategies yield the highest activity for recombinant zebrafish cybrd1?

Effective purification of recombinant cybrd1 requires specialized approaches for membrane proteins:

  • Initial solubilization using mild detergents (DDM, LMNG, or digitonin)

  • Affinity chromatography using engineered tags (His, FLAG, or Strep)

  • Size-exclusion chromatography for final purification and detergent exchange

For related reductases, researchers have utilized approaches such as treating with potassium ferricyanide followed by removal of excess oxidant through Sephadex G25 columns . Special attention must be paid to maintain the native conformation and redox state of the enzyme, potentially requiring anaerobic conditions during certain purification steps.

How can I assess the purity and structural integrity of purified recombinant cybrd1?

Multiple complementary techniques should be employed:

  • SDS-PAGE and Western blotting for purity assessment

  • Circular dichroism (CD) spectroscopy for secondary structure analysis

  • Dynamic light scattering for aggregation analysis

  • Mass spectrometry for identification and post-translational modification analysis

The integrity of the redox center can be assessed using spectrophotometric methods similar to those described for cytochrome b5 reductase, monitoring characteristic absorption peaks that change upon reduction/oxidation .

What are the most reliable methods for measuring zebrafish cybrd1 activity in vitro?

Several approaches can be used to measure ferric reductase activity:

  • Ferrozine assay: Measures Fe2+ formation spectrophotometrically (562 nm)

  • Potassium ferricyanide reduction assay: Monitors absorbance decrease at 420 nm

  • NADPH/NADH consumption assay: Monitors cofactor oxidation at 340 nm

Based on methodologies for related reductases, these assays should be performed under controlled conditions, potentially in anaerobic environments to prevent re-oxidation. For cytochrome b5 reductase, researchers monitored activity using DCPIP at 600 nm and potassium ferricyanide via NADH absorbance at 340 nm . Similar spectrophotometric approaches could be adapted for cybrd1.

What are the typical kinetic parameters for recombinant zebrafish cybrd1?

While specific kinetic parameters for zebrafish cybrd1 are not directly reported in the literature, insights can be drawn from related reductases. For zebrafish cytochrome b5 reductase with different electron acceptors, the following kinetic parameters have been reported:

Electron Acceptorkcat (s−1)KM (μM)
DCPIP260.6
Potassium ferricyanide2353.7

These values were determined by fitting initial reaction rates to the Michaelis-Menten equation . Similar approaches would be appropriate for characterizing cybrd1, though the specific substrates would differ, focusing on various forms of ferric iron.

How do pH and temperature affect zebrafish cybrd1 activity?

Environmental conditions significantly impact reductase activity. For related globin systems, researchers have conducted experiments at both 25°C and 37°C and at different pH values (6.8 and 7.4) . For cybrd1:

  • Optimal pH likely falls between 6.0-7.5, reflecting conditions where iron reduction is physiologically relevant

  • Temperature dependence should be characterized between 20-40°C, with zebrafish physiological temperature (28°C) being particularly relevant

  • Buffer composition affects activity, with phosphates potentially interfering with iron binding

A systematic analysis across pH and temperature ranges would generate an activity profile essential for optimizing experimental conditions.

How can recombinant zebrafish cybrd1 be used to study iron-related pathologies?

Recombinant cybrd1 provides a valuable tool for:

  • Screening potential inhibitors or activators for therapeutic development

  • Understanding molecular mechanisms of iron absorption disorders

  • Comparative studies with human CYBRD1 to identify conserved functional regions

  • Structure-function analyses through site-directed mutagenesis

Studies of cytochrome b5 reductase have demonstrated conservation of function between human and zebrafish systems , suggesting that zebrafish cybrd1 can serve as a model for human iron metabolism disorders. This evolutionary conservation supports translational relevance of findings from the zebrafish model.

What experimental approaches are recommended for analyzing cybrd1 interactions with iron transport proteins?

To characterize protein-protein interactions involving cybrd1:

  • Co-immunoprecipitation with potential partner proteins

  • Proximity ligation assays in cellular contexts

  • Surface plasmon resonance (SPR) for direct binding kinetics

  • Reconstitution experiments in liposomes to assess functional interactions

Research on related systems has successfully employed reconstitution of complete electron transfer systems with multiple components to study functional interactions . Similar approaches could elucidate cybrd1's role within the broader iron metabolism network.

How does the redox potential of cybrd1 influence its biological function?

The redox potential directly determines which substrates cybrd1 can reduce. For related reductases, researchers have measured midpoint potentials using methods involving sodium dithionite as reductant and indigo tetrasulfonate as mediator, analyzing spectral changes using the Nernst equation . For cybrd1:

  • The redox potential must be sufficiently negative to reduce Fe3+ compounds

  • Different iron sources (transferrin, ferritin, dietary iron compounds) may require different reduction potentials

  • Cellular environment (pH, presence of other redox-active molecules) can shift effective potential

Understanding these parameters provides insight into the enzyme's physiological role and substrate preferences.

What are the best strategies for generating cybrd1 knockout or knockdown zebrafish models?

Several approaches can be considered:

  • CRISPR-Cas9 gene editing for complete knockout

  • Morpholino oligonucleotides for transient knockdown

  • Conditional knockout systems using Cre-lox for tissue-specific studies

  • Point mutations to target specific functional domains

When designing these models, researchers should consider potential compensatory mechanisms from related reductases. The search results indicate that zebrafish possess multiple reductase isoforms that may have overlapping functions , necessitating careful validation of phenotypes.

How can I quantitatively assess iron metabolism changes in cybrd1-modified zebrafish models?

Multiple complementary approaches provide comprehensive assessment:

  • Colorimetric assays (ferrozine) for total iron content in tissues

  • Perl's Prussian blue staining for tissue iron distribution

  • qPCR for iron-responsive gene expression changes

  • ICP-MS for precise quantification of iron and other metals

  • Transferrin saturation and ferritin levels as markers of iron status

These approaches should be combined with functional assays, such as measuring hemoglobin levels and hematopoietic parameters, to understand the physiological impact of cybrd1 modification.

What controls are essential for interpreting cybrd1 localization studies in zebrafish tissues?

Rigorous controls for immunohistochemistry or fluorescent protein fusion studies include:

  • Secondary antibody-only controls to assess background staining

  • Competing peptide controls to confirm antibody specificity

  • Knockout/knockdown samples as negative controls

  • Co-localization with established subcellular markers

  • Multiple fixation methods to confirm patterns aren't artifacts

When interpreting results, consider that membrane proteins like cybrd1 may show different localization patterns depending on iron status or developmental stage. The search results indicate that properties of related reductases "may differ notably" across tissues, suggesting that cybrd1 expression and localization patterns may also be tissue-specific.

How should contradictory results in cybrd1 functional studies be interpreted?

When facing contradictory findings:

  • Examine methodological differences (enzyme preparation, assay conditions, iron sources)

  • Consider developmental timing and tissue context differences

  • Evaluate genetic background variations in zebrafish strains

  • Assess whether post-translational modifications were preserved

  • Compare in vitro versus in vivo contexts

As observed with cytochrome b5 isoforms, properties "may differ notably" depending on specific conditions, suggesting that seemingly contradictory results may reflect genuine context-dependent functional differences in cybrd1.

What statistical approaches are most appropriate for analyzing cybrd1 enzyme kinetics data?

Robust statistical analysis should include:

  • Non-linear regression for fitting to Michaelis-Menten or allosteric models

  • Residual analysis to validate model fit

  • Comparison of models using AIC or F-test approaches

  • Bootstrap methods for confidence interval estimation

  • Multiple technical and biological replicates for reproducibility

For related reductases, researchers fitted kinetic data to the Michaelis-Menten equation to determine parameters like kcat and KM . Similar approaches should be applied to cybrd1 kinetics, with appropriate consideration of potential deviations from standard models.

How can I design experiments to distinguish between direct and indirect effects of cybrd1 manipulation?

Rigorous experimental design should include:

  • Rescue experiments reintroducing wild-type or mutant cybrd1

  • Temporal control of knockdown/knockout using inducible systems

  • Parallel assessment of other iron metabolism components

  • Direct measurement of iron reduction capacity in tissues

  • In vitro reconstitution of purified components to confirm direct interactions

These approaches help establish causality and distinguish primary effects from secondary adaptations. As demonstrated in studies of the cytochrome b5/cytochrome b5 reductase system, reconstitution of complete systems with multiple components can provide clear evidence of direct functional relationships .

How can findings from zebrafish cybrd1 studies be translated to human iron disorders?

Translational applications include:

  • Identification of conserved functional domains as therapeutic targets

  • Validation of genetic variants identified in human studies

  • High-throughput screening platforms for modulators of ferric reductase activity

  • Understanding compensatory mechanisms that might affect treatment outcomes

The high degree of conservation between zebrafish and human reductase systems, as demonstrated by functional studies of the cytochrome b5/cytochrome b5 reductase system , supports the translational relevance of zebrafish cybrd1 research.

What methodological approaches best capture the interplay between cybrd1 and other iron metabolism components?

Systems biology approaches offer comprehensive insights:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Network analysis of iron-responsive genes

  • Mathematical modeling of iron absorption and utilization

  • In vivo imaging of iron distribution combined with cybrd1 activity

  • Perturbation studies with multiple genetic manipulations

These approaches help place cybrd1 within the broader context of iron homeostasis, similar to how researchers have studied the cytochrome b5/cytochrome b5 reductase system as part of larger electron transfer networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.