Recombinant Danio rerio Cytochrome c oxidase assembly protein COX14 homolog (si:dkey-222f2.8)

Shipped with Ice Packs
In Stock

Description

Biological Role in Cytochrome c Oxidase Assembly

COX14 homologs are evolutionarily conserved assembly factors that stabilize newly synthesized COX1 subunits and regulate their integration into the COX complex ( ). Key mechanistic insights:

  • Interaction Partners:

    • Binds unassembled COX1 to prevent aggregation ( ).

    • Forms a complex with Coa3 and Mss51 to couple COX1 synthesis with assembly ( ).

    • Required for the COX2 subassembly module in human homologs ( ).

  • Functional Impact:

    • Loss of COX14 disrupts COX assembly, leading to reduced mitochondrial respiration ( ).

    • Stabilizes COX1 during early assembly stages, preventing degradation by proteases like LON or Oma1 ( ).

3.1. Domain Architecture

  • Transmembrane Topology: Single-pass mitochondrial inner membrane protein with a soluble domain facing the intermembrane space ( ).

  • Conserved Motifs: Lacks cysteine residues required for disulfide bonding in mammalian COX4-2, suggesting divergent regulatory mechanisms ( ).

3.2. Evolutionary Context

  • Zebrafish COX14 shares functional homology with human COX14, which coordinates copper delivery to COX2 ( ).

  • Unlike mammalian COX4 isoforms, zebrafish COX14 does not exhibit hypoxia-responsive expression patterns ( ).

4.1. Experimental Use Cases

  • Assembly Studies: Used to probe COX biogenesis defects in zebrafish mitochondrial disease models ( ).

  • Protein-Protein Interaction Screens: Tagged variants (e.g., GFP, Myc-DDK) enable pulldown assays to identify binding partners ( ).

Critical Research Findings

Study FocusKey ResultSource
COX1 Translation RegulationCOX14 stabilizes nascent COX1 and links its synthesis to assembly via Mss51 sequestration
Copper MetabolismHuman COX14 homologs indirectly support copper incorporation into COX2
Hypoxia ResponseZebrafish COX14 lacks hypoxia-responsive elements present in mammalian COX4-2

Challenges and Future Directions

  • Functional Redundancy: Partial COX activity persists in COX16/COX14 knockout models, suggesting backup pathways ( ).

  • Therapeutic Potential: Targeting COX14 interactions could mitigate ROS overproduction in mitochondrial disorders ( ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
si:dkey-222f2.8; Cytochrome c oxidase assembly protein COX14 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-60
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
si:dkey-222f2.8
Target Protein Sequence
MVSGKRIADVGYRLFSGSMMLLTVYGGYLCVVRAQRYMQRKKQLELAAQSENTASEIIKE
Uniprot No.

Target Background

Function
This protein plays a crucial role in the assembly or stability of the cytochrome c oxidase complex (COX).
Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.