Recombinant Danio rerio Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt-co2; coii; cox2; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MAHPAQLGFQDAASPVMEELLCFHDHALMIVFLISTLVLYIIIAMVSTKLTNKFILDSQE IEIVWTVLPAIILILIALPSLRILYLMDEINDPHVTIKAVGHQWYWSYEYTDYENLEFDS YMVPTQDLTPGGFRLLETDHRMVVPKESPIRILVSAEDVLHSWAVPSLGIKMDAVPGRLN QTAFIVSRPGVFYGQCSEICGANHSFMPIVVEAVPLEFFENWSSAMLEDA
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.

Gene References Into Functions
  1. mPGES-1 and COX-2 exhibit developmental coregulation in vasculature. PMID: 15576635
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 in zebrafish and what is its biological significance?

Cytochrome c oxidase subunit 2 (mt-co2) is a critical component of the mitochondrial respiratory chain in Danio rerio (zebrafish). It functions as part of Complex IV (Cytochrome c oxidase), which catalyzes the final step of the electron transport chain with an EC classification of 1.9.3.1 . The protein is encoded by the mitochondrial genome and plays a crucial role in cellular respiration and ATP production. In zebrafish, mt-co2 is particularly significant for studying evolutionary conservation of mitochondrial function across vertebrates, as well as understanding metabolic responses to environmental stressors such as hypercapnia (elevated CO2).

How is recombinant mt-co2 typically produced for research applications?

Recombinant Danio rerio mt-co2 is typically produced using mammalian cell expression systems rather than bacterial systems . The process involves:

  • Gene cloning from zebrafish tissue

  • Vector construction with appropriate tags (tag types are determined during manufacturing)

  • Transfection into mammalian cells

  • Protein expression

  • Purification techniques (commonly affinity chromatography)

  • Quality control testing including SDS-PAGE for purity assessment (>85% purity standard)

While bacterial expression systems like E. coli can be used for some recombinant proteins, mammalian cell systems are often preferred for complex proteins requiring post-translational modifications that affect proper folding and function.

What are the optimal storage conditions for maintaining mt-co2 stability?

The stability and shelf life of recombinant mt-co2 depend on several factors including storage temperature, buffer composition, and physical state. For optimal stability:

FormStorage TemperatureShelf LifeNotes
Liquid-20°C to -80°C6 monthsAvoid repeated freeze-thaw cycles
Lyophilized-20°C to -80°C12 monthsPreferred for long-term storage
Working aliquots4°CUp to one weekFor ongoing experiments

Repeated freezing and thawing significantly reduces protein activity and should be avoided . Instead, prepare small working aliquots for daily use. For reconstituted protein, adding glycerol (final concentration 5-50%, with 50% being typical) helps maintain stability during freeze-thaw cycles when necessary .

How does mt-co2 function change under varying environmental CO2 conditions in zebrafish?

Recent research indicates that zebrafish exhibit non-linear behavioral responses to elevated CO2 levels, which may reflect underlying changes in mitochondrial function including mt-co2 activity. Studies have demonstrated that:

  • Exposure to ~900 μatm CO2 increases anxiety-like behavior

  • Exposure to ~2200 μatm CO2 results in behavior similar to controls

  • Exposure to ~4200 μatm CO2 decreases anxiety-like behavior

These behavioral changes suggest compensatory mechanisms in mitochondrial respiration under different hypercapnic conditions. The non-linear response pattern indicates complex regulation of respiratory chain components, potentially including altered expression or post-translational modifications of mt-co2. This has important implications for understanding how aquatic acidification affects cellular respiration in fish species.

How do post-translational modifications affect mt-co2 function in hypercapnic conditions?

Post-translational modifications of mt-co2 may represent a crucial mechanism for regulating mitochondrial respiration during hypercapnia. While specific data on zebrafish mt-co2 modifications is limited, research in other species suggests several possibilities:

  • Phosphorylation sites that may be modified by kinases responding to altered cellular pH

  • Oxidative modifications in response to changes in reactive oxygen species generation during hypercapnia

  • Potential S-nitrosylation reflecting nitric oxide signaling pathways activated during CO2 stress

These modifications could alter:

Further proteomic analysis using mass spectrometry would be needed to characterize these modifications in zebrafish mt-co2 under various CO2 conditions.

What protocols are recommended for reconstitution of lyophilized mt-co2?

For optimal reconstitution of lyophilized mt-co2, follow this step-by-step protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Gently mix by inversion, avoiding vigorous shaking that can cause protein denaturation

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Store reconstituted protein at -20°C or -80°C for long-term storage, or at 4°C for up to one week

The addition of glycerol serves as a cryoprotectant, reducing ice crystal formation during freezing that could denature the protein. Additionally, the reconstitution buffer may be supplemented with protease inhibitors to prevent degradation, particularly if the protein will be used in prolonged experiments.

How can purification of recombinant mt-co2 be optimized using affinity chromatography?

While specific purification protocols for zebrafish mt-co2 are not detailed in the provided materials, general principles for histidine-tagged recombinant protein purification can be applied:

  • Lysis optimization: For inclusion body solubilization, use binding buffer containing 8M urea (20 mM Tris-HCl, 0.5 M NaCl, 5 mM imidazole, pH 7.9)

  • Column preparation: Equilibrate Ni-chelating column with binding buffer

  • Binding: Apply solubilized protein to column and allow adequate time (≥2 minutes) for His-tag binding to nickel resin

  • Washing: Use binding buffer at 15× column volume to remove non-specifically bound proteins

  • Elution: Use elution buffer (binding buffer with increased imidazole concentration) at 5× column volume

  • Collection: Collect fractions of approximately one column volume each

  • Analysis: Evaluate purification efficiency using SDS-PAGE

  • Dialysis: Perform dialysis for 48 hours to remove salts and denaturants

  • Storage: Store purified protein with 10% glycerol at -20°C

Optimization may require adjusting imidazole concentrations to reduce non-specific binding while maximizing target protein recovery.

What experimental design considerations are important for studying mt-co2 function in hypercapnia models?

When investigating mt-co2 function under hypercapnic conditions, consider these experimental design elements:

  • CO2 concentration range: Test multiple CO2 levels (e.g., ~900, ~2200, and ~4200 μatm) to capture non-linear responses

  • Acclimatization period: Allow sufficient time for physiological adaptation (typically minimum 24-48 hours)

  • Control conditions: Maintain consistent control pCO2 (~480 μatm) across experiments

  • Behavioral endpoints: Include measures of:

    • Anxiety-like behavior (thigmotaxis, transition zone time)

    • Exploratory behavior

    • Locomotion parameters (velocity, immobility time)

  • Tissue collection timing: Harvest tissue at consistent time points relative to CO2 exposure

  • RNA/protein preservation: Flash-freeze samples in liquid nitrogen for molecular analysis

  • Mitochondrial isolation: Consider isolating intact mitochondria for functional studies

  • Statistical power: Ensure adequate sample sizes to detect non-linear responses

This multi-level approach allows correlation between behavioral phenotypes and underlying molecular mechanisms involving mt-co2.

What are the common challenges in achieving high purity recombinant mt-co2 and how can they be addressed?

Several challenges may arise when purifying recombinant mt-co2:

ChallengePotential CauseSolution
Low expression yieldToxicity to host cellsUse inducible expression systems with tight regulation
Codon biasOptimize codons for expression system
Poor solubilityHydrophobic regionsAdd solubilizing tags or fusion partners
Improper foldingAdjust expression temperature (lower often helps)
DegradationProtease activityAdd protease inhibitors during purification
Thermal instabilityMaintain samples at 4°C during processing
Contaminating proteinsNon-specific bindingOptimize imidazole concentration in wash buffers
Incomplete washingIncrease washing volume or add detergents
Low activity after purificationDenaturationUse gentler elution conditions
Loss of cofactorsSupplement with essential cofactors

For mt-co2 specifically, standard purity of >85% by SDS-PAGE is achievable , but higher purity requirements may necessitate additional purification steps such as size exclusion chromatography.

How can researchers verify the functional activity of purified recombinant mt-co2?

Functional validation of recombinant mt-co2 should include:

  • Spectroscopic analysis: Measure characteristic absorption spectra of the heme groups (reduced vs. oxidized)

  • Oxygen consumption assays: Quantify oxygen reduction activity using polarographic methods

  • Electron transfer kinetics: Assess the rate of electron transfer from cytochrome c

  • Proton pumping efficiency: Measure pH changes in reconstituted liposomes

  • Inhibitor sensitivity: Test response to known inhibitors (e.g., cyanide, azide)

  • Thermal stability assays: Evaluate protein stability at different temperatures

  • Circular dichroism: Confirm proper secondary structure

These assays should be performed under physiologically relevant conditions, including pH values and temperatures that reflect the zebrafish natural environment.

What considerations are important when integrating mt-co2 data with broader OXPHOS function studies?

When contextualizing mt-co2 findings within broader oxidative phosphorylation (OXPHOS) research:

This integrative approach helps establish the role of mt-co2 within the complex network of mitochondrial energy metabolism and stress response pathways in zebrafish.

What are the promising areas for future research involving zebrafish mt-co2 in climate change models?

The non-linear behavioral responses of zebrafish to varying CO2 levels suggest complex underlying mechanisms involving mitochondrial function . Future research directions could include:

  • Comparative proteomics: Profiling changes in mt-co2 expression and post-translational modifications across CO2 exposure levels

  • Mitochondrial bioenergetics: Measuring respiratory capacity and efficiency under progressive hypercapnia

  • Transgenic models: Developing reporter systems to visualize mt-co2 activity in vivo

  • Multi-stressor studies: Investigating combined effects of elevated CO2 with temperature changes or hypoxia

  • Tissue-specific responses: Comparing mt-co2 regulation in brain versus gill tissue under hypercapnia

  • Developmental vulnerability windows: Identifying critical periods when mt-co2 function is most susceptible to CO2 perturbation

  • Epigenetic regulation: Exploring potential transgenerational adaptations in mt-co2 expression

These approaches would help elucidate the molecular mechanisms underlying the observed hormetic response to CO2 and inform predictions about fish adaptation to climate change.

How might mt-co2 function interact with TASK-2 channels in neuronal CO2 sensing?

Building on existing research on TASK-2 channels in zebrafish CO2 sensing , future studies could explore:

  • Co-localization analysis: Determining if mt-co2 and TASK-2 channels are expressed in the same neuroepithelial cells

  • Functional coupling: Investigating if mitochondrial respiration (involving mt-co2) directly modulates TASK-2 channel activity

  • Calcium imaging: Examining if altered mt-co2 function affects calcium signaling in chemosensory pathways

  • Genetic interaction studies: Using morpholino knockdown of both mt-co2 and TASK-2 to assess phenotypic interactions

  • Pharmacological manipulation: Applying specific inhibitors of Complex IV to determine effects on TASK-2-mediated CO2 sensing

These investigations would help establish the potential role of mitochondrial metabolism in modulating neuronal CO2 sensing mechanisms in zebrafish.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.