Recombinant Danio rerio DBH-like monooxygenase protein 1 homolog (moxd1)

Shipped with Ice Packs
In Stock

Description

Protein Structure

  • Accession: Q5TZ24 (UniProtKB)

  • Length: 614 amino acids (partial recombinant form)

  • EC Classification: 1.14.17.- (unclassified monooxygenase)

  • Localization: Endoplasmic reticulum (non-secreted)

Functional Role

Moxd1 shares structural motifs with DBH and peptidylglycine alpha-hydroxylating monooxygenase (PHM), suggesting a role in copper-dependent catalysis . While its endogenous substrate remains undefined, it is implicated in:

  • Catecholamine metabolism: Structural homology to DBH and PHM

  • Tumor suppression: Acts as a lineage-specific suppressor in neuroblastoma

Role in Neuroblastoma

Moxd1 is critical in regulating neuroblastoma progression:

Study ModelFindingsClinical ImplicationsSources
Zebrafish (MYCN-TT)MOXD1 knockout increases tumor penetrance (100%) and reduces connective tissuePredicts poor prognosis in low-MOXD1 tumors
Human CohortsLow MOXD1 expression correlates with advanced disease and reduced survivalBiomarker for neuroblastoma stratification
CRISPR-Cas9 KOLoss of MOXD1 enhances embryonic lethality and tumor aggressiveness in SH-EP cellsValidates lineage-specific tumor suppression

Mechanistic Insights

  • Glioblastoma (GBM): MOXD1 knockdown reduces proliferation via G2/M arrest and downregulates CDK1/2, Cyclin A1/B1 .

  • Developmental Regulation: Expressed in Schwann cell precursors and mesenchymal neuroblastoma cells, highlighting lineage-specific functions .

Experimental Uses

  • Blocking assays: Validated for neutralizing endogenous MOXD1 activity (e.g., in tumor biology studies) .

  • Biochemical studies: Investigates copper-dependent enzymatic activity and substrate specificity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
moxd1; si:ch211-193l17.1; si:dkey-266k12.5; si:dkeyp-119b4.5; DBH-like monooxygenase protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-614
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
moxd1
Target Protein Sequence
QGTRFVHSAALDAERRYNIKWGFDESTITFEIEVETRGYVGFGLSPTGAMSSSDIVIGGV LNGSPYLLDYFTDSNRKVHRDPLQNYELLYGRENDTHTVLAFSRNLQTCDDNDKIITGST VRVIWAFHAEDVGESGLVYHGMNRGRKSLRLLNPGTGPSIPAGTAFFDLQNKEVPVPHKD TTYWCQIFRFPEMKKKHHVIRIEPLIQKGHENLVHHILLYQCDSNLNKSEVNRGHECYHP NMPDSFLTCETVLFAWAIGGEGFTYPPHVGMSIGTSIDPVYVQLEIHFDNPSLQGGIVDS SGLRLYYSPSLRRYDAGVIETGVWVSLYHMLPPGMTDYITEGHCTQECLQESLDSEMPSG VHVFAVLLHAHLAGRAITARHFRQQLELQPLASDDQFDFNFQEFQPLSQERLILPGDSLI TECRYNTKGRMNMTWGGLSTREEMCLSFLLYYPRVNLAKCESLPEIAGQLKFIGVTEIQE PVTTWPFVIKSPKKYSNLSFTEAMDKYKWTMKKGKSFNDIVRKLPMNVRCSKTGQDEWSI QGMIVSPPEVRSEQTSTAVVACRKDSAIQCEHSLALLLTACLLLILQTCLHL
Uniprot No.

Target Background

Database Links
Protein Families
Copper type II ascorbate-dependent monooxygenase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the genomic location and structure of moxd1 in Danio rerio?

Danio rerio moxd1 is located on chromosome 20 according to the zebrafish genome database. The gene encodes multiple transcript variants, with the primary transcript (moxd1-201) spanning 3,903 nucleotides. Two additional variants exist: moxd1-202 (1,845 nucleotides) and moxd1-203 (974 nucleotides). The protein belongs to the copper-dependent monooxygenase family, containing several conserved domains including the DOMON domain, copper type II ascorbate-dependent monooxygenase domains (both N-terminal and C-terminal), and dopamine beta-hydroxylase-like domains .

What are the predicted biochemical functions of zebrafish moxd1?

The zebrafish moxd1 protein is predicted to enable copper ion binding activity and dopamine beta-monooxygenase activity. It is likely involved in several key metabolic pathways including dopamine catabolism, norepinephrine biosynthesis, and octopamine biosynthetic processes. These predictions suggest a critical role in catecholamine metabolism similar to its homologs in other species. At the subcellular level, moxd1 is predicted to localize to the endoplasmic reticulum membrane and may be active in the extracellular space and secretory granule membrane .

How is moxd1 expression regulated during zebrafish development?

While specific zebrafish expression data is limited in the provided search results, comparative analysis with other species suggests that moxd1 expression is likely restricted to neural crest derivatives during development. In humans and other model organisms, MOXD1 expression is highly conserved and restricted to mesenchymal neuroblastoma cells and Schwann cell precursors during healthy development . Researchers investigating developmental expression patterns should consider techniques such as whole-mount in situ hybridization at various developmental stages to track moxd1 expression in zebrafish embryos.

What methodologies are optimal for CRISPR-Cas9 knockout of moxd1 in zebrafish models?

For CRISPR-Cas9 knockout of moxd1 in zebrafish, researchers should design multiple guide RNAs targeting conserved functional domains of the moxd1 gene. Based on neuroblastoma research models, effective CRISPR strategies have demonstrated high mutation efficiency, as confirmed in tumors dissected at 27 weeks post-fertilization . The experimental approach should include:

  • Design of at least 3-4 guide RNAs targeting early exons or critical functional domains

  • Validation of CRISPR efficiency using T7 endonuclease assays or direct sequencing

  • Confirmation of protein ablation using Western blot or immunofluorescence

  • Assessment of phenotypic changes in neural crest derivatives and related structures

Researchers should consider using the Tg(dbh:EGFP) transgenic line to facilitate visualization of cell populations of interest when studying moxd1 function, similar to the approach used in oncogenic models .

How does moxd1 knockout affect neuroblastoma tumor formation in zebrafish models?

In zebrafish neuroblastoma models, knockout of moxd1 significantly increases tumor penetrance. In the Tg(dbh:MYCN; dbh:EGFP) zebrafish model, which coexpresses enhanced green fluorescent protein (eGFP) and human MYCN under the control of the zebrafish dbh promoter, baseline tumor penetrance was approximately 79%. When moxd1 was knocked out with high CRISPR mutation efficiency, tumor penetrance increased to 100% . This supports the tumor suppressor role of moxd1 observed in other vertebrate models.

For researchers investigating this phenomenon, the following methodological approaches are recommended:

  • Establish baseline tumor formation rates in control animals

  • Confirm moxd1 knockout efficiency at both genetic and protein levels

  • Use fluorescent reporter systems (e.g., GFP-labeled tumor cells) for quantification

  • Analyze tumor histology, growth patterns, and invasive properties

  • Consider single-cell RNA sequencing to characterize tumor heterogeneity

What is the relationship between moxd1 expression and cell phenotypes in neuroblastoma models?

MOXD1 expression patterns correlate strongly with specific neuroblastoma cell phenotypes. Analysis of single-cell RNA sequencing data from human neuroblastoma cells reveals that MOXD1 expression is low in noradrenergic cell clusters but high in undifferentiated mesenchymal-like (MES-like) tumor cell clusters . Furthermore, MOXD1 expression is elevated in mesenchymal (MES) and epithelial-mesenchymal transition (EMT) groups with previously unknown clinical and biological features .

This relationship suggests that moxd1 may play a role in cell identity determination or maintenance. When investigating this relationship in zebrafish models, researchers should:

  • Use single-cell RNA sequencing to identify cell clusters based on expression profiles

  • Correlate moxd1 expression with established mesenchymal and adrenergic markers

  • Perform gain/loss-of-function studies to assess phenotype switching

  • Evaluate changes in cell motility, proliferation, and differentiation capacity

What are the best expression systems for producing recombinant Danio rerio moxd1 protein?

For production of recombinant Danio rerio moxd1 protein, several expression systems can be considered, each with advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications, potential folding issues for complex proteinsDomain-specific studies, antibody production
Insect cellsBetter post-translational modifications, suitable for complex proteinsModerate cost, longer production timeStructural studies, enzyme activity assays
Mammalian cellsNative-like post-translational modificationsHigher cost, lower yield, complex protocolsFunctional studies, protein-protein interactions
Cell-free systemsRapid, avoids cellular toxicityLimited scaling, higher costInitial screening, small-scale functional assays

Given that moxd1 is predicted to be a membrane-associated protein with complex domains including the copper-binding region, insect cell or mammalian cell expression systems would likely yield the most functionally relevant protein for enzymatic studies.

What analytical methods are most effective for assessing moxd1 enzymatic activity?

For analyzing the enzymatic activity of moxd1, which is predicted to function as a copper-dependent monooxygenase similar to dopamine beta-hydroxylase, the following analytical methods are recommended:

  • Spectrophotometric assays: Measure changes in substrate/product concentrations using specific wavelengths

  • HPLC analysis: Quantify catecholamine metabolites with high sensitivity

  • Radiometric assays: Use radiolabeled substrates to track conversion rates

  • Oxygen consumption measurements: Monitor O₂ utilization during enzymatic reactions

  • Coupled enzyme assays: Link moxd1 activity to secondary reactions with easily detectable products

A typical enzymatic activity assay would include the following components:

  • Purified recombinant moxd1 protein

  • Appropriate substrate (based on predicted function in dopamine/norepinephrine pathways)

  • Copper as a cofactor

  • Ascorbate as an electron donor

  • Appropriate buffer conditions (pH 6.5-7.5)

  • Controls including heat-inactivated enzyme and reactions without cofactors

How can researchers effectively model the tumor suppressor function of moxd1 in zebrafish?

To model the tumor suppressor function of moxd1 in zebrafish, a comprehensive approach combining genetic manipulation with in vivo imaging and molecular analysis is recommended:

  • Genetic approaches:

    • CRISPR-Cas9 knockout of moxd1 in wild-type or tumor-prone zebrafish lines

    • Conditional knockdown using inducible systems or tissue-specific promoters

    • Rescue experiments with wild-type moxd1 overexpression

  • Tumor induction models:

    • Use established models like Tg(dbh:MYCN; dbh:EGFP) that have a baseline tumor formation rate of 79%

    • Monitor changes in tumor penetrance, onset, and progression after moxd1 manipulation

    • Quantify tumor burden using fluorescent reporters and advanced imaging

  • Analysis methods:

    • Histological examination of tumor tissues

    • Transcriptomic profiling to identify altered pathways

    • Cell migration and invasion assays to assess metastatic potential

    • Survival analysis of zebrafish with different moxd1 status

A comparative approach examining phenotypes across different experimental conditions would provide robust data:

Experimental GroupExpected Tumor PenetranceAnalysis TimepointsKey Endpoints
Wild-type controlsMinimal/none12, 24, 36 wpfBackground tumor rate
MYCN-TT controls~79%12, 24, 36 wpfBaseline tumor formation
MYCN-TT + moxd1 KO~100%12, 24, 36 wpfEnhanced tumorigenesis
MYCN-TT + moxd1 overexpression<79%12, 24, 36 wpfTumor suppression

How does zebrafish moxd1 function compare to human MOXD1 in tumor suppression?

The tumor suppressor function of MOXD1 appears to be conserved across species. Research indicates that MOXD1 expression is highly conserved between humans, chickens, mice, and zebrafish . When studying comparative functions, researchers should consider:

  • Sequence homology analysis between human and zebrafish proteins

  • Conservation of functional domains and critical residues

  • Cross-species functional complementation studies

  • Comparative expression pattern analysis during development

The tumor suppressor role observed in human neuroblastoma models, where loss of MOXD1 associates with advanced disease and worse outcome , appears to be conserved in zebrafish models where moxd1 knockout increases tumor penetrance . This suggests that zebrafish can serve as a valid model for studying MOXD1-related tumor suppression mechanisms with potential translational relevance.

What are the molecular mechanisms underlying moxd1's tumor suppressor activity?

While the exact molecular mechanisms of moxd1's tumor suppressor activity remain to be fully elucidated, several potential pathways can be investigated:

  • Cell differentiation regulation: MOXD1 expression is restricted to mesenchymal neuroblastoma cells and Schwann cell precursors during development , suggesting a role in cell fate determination.

  • Phenotype maintenance: MOXD1 is expressed in mesenchymal (MES) phenotypic cells but not in adrenergic (ADRN) phenotypic cells , indicating potential involvement in maintaining specific cell states.

  • Metastasis inhibition: In experimental models, MOXD1 knockout cells showed increased migratory behavior , suggesting that MOXD1 may suppress metastatic potential.

  • Enzymatic function: As a predicted copper-dependent monooxygenase, moxd1 may regulate catecholamine metabolism, which could influence cell growth and differentiation pathways.

Researchers investigating these mechanisms should employ approaches including:

  • RNA-seq to identify differentially expressed genes after moxd1 manipulation

  • ChIP-seq to determine potential transcriptional regulatory networks

  • Metabolomic analysis to identify altered catecholamine profiles

  • Protein-protein interaction studies to identify binding partners

How can single-cell transcriptomics enhance our understanding of moxd1 function in zebrafish?

Single-cell RNA sequencing (scRNA-seq) has emerged as a powerful tool for understanding cellular heterogeneity and gene function in development and disease. For moxd1 research in zebrafish, scRNA-seq can:

  • Identify specific cell populations expressing moxd1 during development

  • Track changes in cellular states following moxd1 knockout or overexpression

  • Reveal co-expression patterns that suggest functional relationships

  • Define the temporal dynamics of moxd1 expression during neural crest differentiation

Recent studies in human neuroblastoma have utilized scRNA-seq to demonstrate that MOXD1 expression is low in noradrenergic cell clusters but high in undifferentiated MES-like tumor cell clusters . Similar approaches in zebrafish could provide valuable insights into evolutionary conservation of moxd1 function and identify zebrafish-specific aspects of its biology.

What are the potential applications of moxd1 research in personalized medicine approaches for neuroblastoma?

Research on MOXD1 has significant implications for personalized medicine approaches to neuroblastoma treatment:

  • Prognostic biomarker: Low expression or loss of MOXD1 correlates with unfavorable disease in neuroblastoma , suggesting its potential use as a prognostic biomarker.

  • Tumor stratification: MOXD1 status could help further stratify neuroblastoma tumors, potentially identifying patient subgroups that might benefit from specific therapeutic approaches.

  • Therapeutic target: Understanding pathways affected by MOXD1 loss could reveal new therapeutic vulnerabilities in MOXD1-low tumors.

  • Drug screening platform: Zebrafish moxd1 models could serve as efficient in vivo platforms for screening compounds that might restore tumor suppressor function or target vulnerabilities created by moxd1 loss.

For translational researchers, zebrafish models offer advantages including:

  • High-throughput screening capability

  • Visualization of tumor formation in real-time

  • Genetic tractability

  • Cost-effectiveness compared to mouse models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.