Recombinant Danio rerio DDB1- and CUL4-associated factor 17 (dcaf17)

Shipped with Ice Packs
In Stock

Description

Functional and Biological Significance

  • Role in Ubiquitination: Dcaf17 acts as a substrate receptor in the CRL4 ubiquitin ligase complex, targeting specific proteins for proteasomal degradation .

  • Reproductive Biology: Knockout studies in mice revealed that Dcaf17 deletion causes male infertility due to impaired spermatogenesis, including abnormal acrosome formation and nuclear compaction .

  • Disease Associations: Orthologs in humans (DCAF17) are linked to Woodhouse-Sakati syndrome, a rare genetic disorder characterized by hypogonadism and neurological defects .

Research Applications

  • Protein-Protein Interaction Studies: Used to investigate CRL4 complex dynamics .

  • Spermatogenesis Models: Zebrafish dcaf17 provides insights into conserved mechanisms of germ cell development .

  • Disease Mechanism Analysis: Functional studies of dcaf17 mutations help elucidate molecular pathways in Woodhouse-Sakati syndrome .

Key Research Findings

  • Knockout Phenotypes: Dcaf17⁻/⁻ mice exhibit vacuolated seminiferous tubules and non-motile sperm, highlighting its necessity for spermiogenesis .

  • Conservation Across Species: Zebrafish dcaf17 shares structural homology with human and rodent variants, making it a viable model for translational studies .

  • Therapeutic Potential: Targeting dcaf17 interactions could modulate ubiquitination pathways in diseases like cancer or genetic syndromes .

Technical Considerations

  • Storage: Lyophilized powder stable at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Activity Assays: SDS-PAGE remains the primary method for purity validation, though functional assays (e.g., ubiquitination assays) are recommended for activity confirmation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dcaf17; si:ch211-245g15.4; DDB1- and CUL4-associated factor 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-526
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
dcaf17
Target Protein Sequence
MCALPSPRAQRPPACTRTSKNSCALLASRYNGSCSNDFGRLLASNLKILRNIILKDDTEF VKVWSKTSKSLISYESGRIYFDNYRCCYSSLLPEPELLYELPRTPKTEKIEDALLCQCPL ENVLPNASEQKSCLLTLTANNWLYLLSADTGETLQRVYLSSRFKFSRSLGWDSSQETFYV KSVQCKQTALERQAGVDNNILMRVAAFQVFPLQLVGMLEINKKVFGKTAVDVLLSQGVLA VSHSSKLVRLYSFEYIVNKFRTEELILGQQCELNNARGIVGDAPYGVPVNICIHECPPVL FEMTYFENGVQIGGHPWHYIYTPNHKRHRGTHHVCSITDGALAKNGVQDMKCDSLEVDWI FFHPDDSGRIIHAGPSTINILKIMAETGCDWKYEIITDFSITAARDSNASQVIVTSSGRT VKRRFQMLDDDPAQETFRMVKYEDELDLLAVVDITHAEDEGQARLRLHDNKTGALMKRVP LEEPWDVTYSHEVYFDRDTIIHTVQEKNNSFCCHVYKMKRPASDQP
Uniprot No.

Target Background

Function
May serve as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus, nucleolus. Note=Has been shown in human and mouse to be a nucleolar protein, while sequence analysis programs clearly predict 2 transmembrane regions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.