Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH2 (41335)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH2 (41335) refers to a specific protein, MARCH2, which functions as an E3 ubiquitin ligase in the zebrafish (Danio rerio). E3 ubiquitin ligases are enzymes that play a critical role in the ubiquitination process, where ubiquitin molecules are attached to target proteins, leading to their degradation or alteration in function .

Gene Information

The gene that encodes the MARCH2 protein is referred to as march2. The human form of this gene is called MARCH2 membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase [ Homo sapiens ] . Synonyms for this gene include RNF172, HSPC240, and MARCH-II . The Gene ID is 51257 .

Table 1: Gene Information for Human MARCH2

Gene NameMARCH2 membrane-associated ring finger (C3HC4) 2, E3 ubiquitin protein ligase [Homo sapiens]
Official SymbolMARCH2
SynonymsRNF172; HSPC240; MARCH-II
Gene ID51257
mRNA RefseqNM_001005416
Protein RefseqNP_001005416
MIM613332
UniProt IDQ9P0N8
Chromosome Location19p13.2
Functionubiquitin-protein ligase activity; zinc ion binding

Protein Function

MARCH2 is an E3 ubiquitin ligase, meaning it facilitates the transfer of ubiquitin to specific target proteins. Ubiquitination is a crucial post-translational modification that regulates a wide array of cellular processes, including protein degradation, signal transduction, and immune response .

Recombinant Production

Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH2 (41335) is produced using genetic engineering techniques. The gene encoding MARCH2 from Danio rerio is inserted into an expression vector, which is then introduced into host cells (e.g., E. coli) to produce the protein . The recombinant protein can be expressed with a His-tag for purification purposes .

Related Products

Creative BioMart offers Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase March2(41335) Protein, His-Tagged, for inquiry .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its incorporation into the production process.
Synonyms
marchf2; march2; si:ch211-197g15.3; zgc:158704; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING-type E3 ubiquitin transferase MARCHF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
march2
Target Protein Sequence
MTTGECCHLPGSLCDCTGNAALSKTVEEADNRRAQYVTQVTAKDGRLLSTVIKALGTQSD RPICRICHEGQDVCNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIER RPRPLTEWLRDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLHFNSRLEAVG LIALTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVRLLIPDTKGAHSTQHSLLSTKLL KKTADETIV
Uniprot No.

Target Background

Function

MARCH2 (Membrane-Associated Ring-CH-type Zinc Finger 2) is a Danio rerio (zebrafish) E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme (as a thioester) and directly transfer it to target substrates.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Q&A

How does MARCH2 differ from other MARCH family proteins in zebrafish?

The MARCH (Membrane-Associated RING-CH) family in zebrafish includes several members with distinct substrate specificities and functions:

  • Substrate specificity:

    • MARCH2 specifically targets ERGIC3 (ER-Golgi intermediate compartment protein 3) for ubiquitination and degradation

    • MARCH2 selectively downregulates VE-cadherin but not N-cadherin

    • MARCH8 targets E-cadherin for ubiquitination and modulates cell adhesion in zebrafish embryos

    • MARCH4 does not significantly affect VE-cadherin levels

  • Functional differences:

    • MARCH2 regulates protein trafficking in the early secretory pathway

    • MARCH8 functions in embryonic development by modulating cell adhesion through regulation of E-cadherin localization

  • Structural comparison:
    Both MARCH2 and MARCH4 contain RING-CH domains, but differences in other regions likely contribute to their distinct substrate preferences .

To differentiate between MARCH family members experimentally:

  • Use specific antibodies or tagged constructs to detect individual MARCH proteins

  • Perform substrate specificity assays using recombinant proteins

  • Create domain-swap chimeras to identify regions responsible for differential substrate recognition

  • Generate specific knockdown or knockout models for each family member

What are the optimal storage and handling conditions for recombinant MARCH2 protein?

For maximum stability and activity of recombinant Danio rerio E3 ubiquitin-protein ligase MARCH2, researchers should follow these storage and handling guidelines:

Storage conditions:

  • Store stock solution at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

Handling protocols:

  • Avoid repeated freeze-thaw cycles as they can significantly reduce activity

  • Store working aliquots at 4°C for up to one week

  • Thaw frozen aliquots slowly on ice prior to use

  • When diluting, consider the effect of buffer components on your experimental system

Quality control measures:

  • Prior to experiments, verify protein activity using in vitro ubiquitination assays

  • Assess protein integrity by SDS-PAGE

  • For critical applications, consider testing multiple aliquots to ensure reproducibility

What model systems are most appropriate for studying MARCH2 function?

Several model systems can be employed to study MARCH2 function, each with specific advantages:

  • Zebrafish (Danio rerio) embryos:

    • Advantages: Transparent, rapid development, amenable to genetic manipulation

    • Applications: Developmental roles, tissue-specific functions, real-time visualization

    • Methods: Morpholino knockdown, CRISPR/Cas9 knockout, mRNA injection for overexpression

  • Cell culture systems:

    • Zebrafish-derived cell lines: Retain species-specific interactions

    • Human/mammalian cell lines: More tools available, especially for studying conserved functions

    • Applications: Biochemical assays, protein-protein interactions, subcellular localization

    • Methods: Transfection/transduction, CRISPR knockout, RNAi knockdown

  • In vitro biochemical systems:

    • Reconstituted ubiquitination reactions with purified components

    • Advantages: Precise control over reaction conditions, direct measurement of activity

    • Applications: Substrate identification, mechanistic studies, inhibitor screening

  • Comparative systems across species:

    • Compare MARCH2 function in zebrafish, Xenopus, and mammalian systems

    • Applications: Evolutionary conservation, species-specific adaptations

Selection criteria based on research questions:

  • For developmental studies: Zebrafish embryos

  • For mechanistic biochemistry: In vitro systems with purified components

  • For cell biology: Cell culture models

  • For translational relevance: Consider both zebrafish and mammalian systems

How can researchers effectively design experiments to study MARCH2-mediated ubiquitination in zebrafish models?

Designing robust experiments to study MARCH2-mediated ubiquitination in zebrafish requires careful planning of multiple components:

Experimental approaches for in vivo studies:

  • Genetic manipulation strategies:

    • Morpholino-mediated knockdown for transient effects

    • CRISPR/Cas9 for stable genetic knockout

    • mRNA injection for overexpression studies

    • Use of tissue-specific or inducible promoters for targeted expression

  • Key controls:

    • Ligase-dead MARCH2 mutants (mutations in RING domain: C64S, C67S, H90Q)

    • Rescue experiments with wild-type MARCH2

    • Non-targeting morpholinos or control CRISPR guides

    • Dose-response relationships for overexpression

  • Detection of ubiquitination:

    • Immunoprecipitation followed by immunoblotting with anti-ubiquitin antibodies

    • Use of linkage-specific antibodies (e.g., K48-linked chains for degradation)

    • Mass spectrometry to identify ubiquitination sites on substrates

    • Comparison of substrate protein levels between wild-type and MARCH2-deficient embryos

  • Data analysis considerations:

    • Quantify band intensities in Western blots

    • Statistical analysis comparing experimental and control groups

    • Consider developmental timing when interpreting results

    • Correlate biochemical findings with phenotypic outcomes

What role does MARCH2 play in regulating protein trafficking between the ER and Golgi in zebrafish?

MARCH2 serves as a critical regulator of protein trafficking in the early secretory pathway, particularly through its effects on ERGIC3:

MARCH2 regulation of ERGIC3:

  • MARCH2 directs ubiquitination and subsequent degradation of ERGIC3 (ER-Golgi intermediate compartment protein 3)

  • Lysine residues at positions 6 and 8 of ERGIC3 are the major sites of MARCH2-mediated ubiquitination

  • MARCH2 depletion increases endogenous ERGIC3 levels

  • MARCH2 does not significantly decrease levels of ERGIC3 variants with lysine-to-arginine substitutions at residues 6 and 8

Impact on secretory cargo:

  • ERGIC3 binds to specific cargo proteins, including α1-antitrypsin and haptoglobin

  • ERGIC3 depletion decreases secretion of these proteins

  • MARCH2 reduces secretion of α1-antitrypsin and haptoglobin

  • Coexpression of ubiquitination-resistant ERGIC3 largely restores secretion

ERGIC complex dynamics:

  • ERGIC3 forms complexes with itself or with ERGIC2

  • These proteins are orthologs of yeast Erv41 and Erv46, which form a heteromeric complex

  • They cycle between the ER and Golgi and function as cargo receptors in both anterograde and retrograde protein trafficking

Experimental approaches to study this pathway:

  • Generate MARCH2 knockout or knockdown zebrafish lines

  • Analyze secretion of endogenous proteins

  • Create transgenic lines expressing fluorescent secretory cargo

  • Use live imaging to track cargo movement through the secretory pathway

  • Perform rescue experiments with wild-type versus mutant MARCH2

What strategies can be used to identify novel MARCH2 substrates in zebrafish?

Identifying novel MARCH2 substrates in zebrafish requires a multi-faceted approach combining proteomics, biochemistry, and genetics:

1. Proteomics-based approaches:

a) Global proteome analysis:

  • Compare protein abundance in wild-type versus MARCH2-deficient zebrafish

  • Focus on proteins showing increased levels in MARCH2 knockouts

  • Use stable isotope labeling (SILAC) or label-free quantification

  • Analyze data with appropriate statistical tools

b) Ubiquitinome analysis:

  • Enrich for ubiquitinated peptides using antibodies against the GG-remnant

  • Compare ubiquitination profiles between wild-type and MARCH2-deficient samples

  • Identify proteins with decreased ubiquitination in MARCH2 knockouts

c) Proximity labeling:

  • Create MARCH2 fusion proteins with BioID, TurboID, or APEX2

  • Express in zebrafish embryos using tissue-specific promoters

  • Purify biotinylated proteins and identify by mass spectrometry

2. Biochemical validation approaches:

a) In vitro ubiquitination assays:

  • Test candidate substrates identified in proteomic screens

  • Use purified recombinant proteins

  • Confirm direct ubiquitination by MARCH2

b) Co-immunoprecipitation:

  • Use tagged MARCH2 to pull down interacting proteins

  • Include proteasome inhibitors to stabilize substrates

  • Use ligase-dead MARCH2 which often forms more stable complexes with substrates

c) Ubiquitination site mapping:

  • Identify lysine residues modified by MARCH2

  • Generate lysine-to-arginine mutants to confirm sites

  • Test resistance to MARCH2-mediated degradation

3. Genetic and cell-based validation:

a) Expression correlation analysis:

  • Analyze co-expression patterns in single-cell RNA-seq data

  • Focus on membrane proteins with expression patterns overlapping MARCH2

b) Substrate stabilization assays:

  • Observe protein accumulation after MARCH2 knockout/knockdown

  • Test if re-expression of MARCH2 restores degradation

  • Compare effects of wild-type versus ligase-dead MARCH2

c) Functional validation:

  • Determine if substrate stabilization recapitulates MARCH2 knockout phenotypes

  • Test if substrate-resistant mutants (K→R) mimic MARCH2 deficiency

How do researchers effectively compare the functions of MARCH2 across different vertebrate species?

Comparative analysis of MARCH2 function across vertebrate species requires integrated approaches across multiple levels:

1. Sequence and structural analysis:

  • Perform multiple sequence alignments of MARCH2 proteins across species

  • Identify conserved domains and species-specific variations

  • Construct phylogenetic trees to understand evolutionary relationships

  • Use homology modeling to predict structural conservation

2. Cross-species complementation:

  • Express MARCH2 from different species (human, mouse, zebrafish) in zebrafish MARCH2 knockout models

  • Assess rescue of phenotypes to determine functional conservation

  • Create chimeric proteins with domains from different species to identify functionally divergent regions

3. Substrate specificity analysis:

  • Compare ubiquitination targets across species

  • Test whether zebrafish MARCH2 recognizes mammalian substrates and vice versa

  • Use in vitro ubiquitination assays with recombinant proteins from different species

  • Identify conserved and species-specific substrate recognition motifs

4. Comparative phenotypic analysis:

SpeciesExperimental ApproachPhenotypic ReadoutsReference
ZebrafishMorpholino knockdown
CRISPR knockout
Development
Protein trafficking
Cell adhesion
MouseTargeted knockout
Conditional knockout
Immune function
Protein secretion
Tissue homeostasis
Human cellsCRISPR knockout
RNAi knockdown
Vesicular trafficking
Protein degradation
Barrier function

5. Regulatory network comparison:

  • Use single-cell transcriptomics to compare expression patterns across species

  • Identify conservation and divergence in co-expression networks

  • Map regulatory elements controlling MARCH2 expression in different species

6. Specialized methodologies:

  • Ancestral sequence reconstruction to infer and test function of ancient MARCH2

  • CRISPR-mediated replacement of zebrafish MARCH2 with orthologs from other species

  • Advanced imaging to compare subcellular localization across species

  • Cross-species proteomics to systematically compare substrates

How can researchers measure the effect of MARCH2 on endothelial barrier function in zebrafish?

Studying MARCH2's effects on endothelial barrier function in zebrafish requires specialized techniques spanning multiple scales:

1. In vivo barrier function assays:

a) Vascular leakage assays:

  • Inject fluorescent dextrans of different molecular weights into circulation

  • Image extravasation over time using confocal microscopy

  • Quantify leakage by measuring extravascular fluorescence intensity

  • Compare wild-type versus MARCH2 knockout/knockdown embryos

b) Transgenic reporter approaches:

  • Use double transgenic lines: Tg(kdrl:GFP) to visualize endothelial cells and Tg(fli1:mCherry) for vascular structure

  • Assess junction integrity through localization of fluorescently tagged junction proteins

  • Create transgenic lines expressing fluorescent VE-cadherin to directly monitor MARCH2 effects

2. Molecular assessment of junction proteins:

a) Protein localization analysis:

  • Whole-mount immunostaining for VE-cadherin and other junction proteins

  • Confocal microscopy to assess localization at cell borders

  • Quantify junction continuity and intensity

  • Compare effects of wild-type versus ligase-dead MARCH2

b) Biochemical analysis:

  • Isolate vascular endothelial cells from zebrafish embryos using FACS

  • Assess VE-cadherin ubiquitination status

  • Measure total and surface levels of VE-cadherin

  • Analyze other junction components (p120-catenin, β-catenin)

3. Functional assessment of vascular integrity:

a) Edema formation:

  • Quantify pericardial and yolk sac edema as indicators of vascular leak

  • Use standardized scoring systems to assess severity

b) Inflammatory responses:

  • Monitor leukocyte extravasation using Tg(mpx:GFP) transgenic lines

  • Assess inflammatory responses to vascular damage

c) Vessel perfusion analysis:

  • Inject quantum dots or fluorescent microbeads

  • Assess blood flow patterns and vessel perfusion

  • Identify areas of reduced flow or hemorrhage

4. Advanced cell-based approaches:

a) Electric cell-substrate impedance sensing (ECIS):

  • Isolate primary endothelial cells from wild-type and MARCH2-deficient zebrafish

  • Culture on ECIS electrodes to measure barrier function in real-time

  • Compare with human endothelial cells expressing zebrafish MARCH2

b) Transmigration assays:

  • Assess leukocyte transmigration across endothelial monolayers

  • Compare barrier function in cells with varying MARCH2 expression

5. Experimental validation:

  • Rescue experiments with wild-type versus ligase-dead MARCH2

  • Test VE-cadherin mutants resistant to MARCH2-mediated ubiquitination

  • Determine if VE-cadherin overexpression rescues barrier defects in MARCH2-overexpressing endothelium

What are the critical considerations when studying MARCH2 interactions with the immune system in zebrafish models?

Investigating MARCH2's role in immune regulation in zebrafish requires careful experimental design and specialized techniques:

1. Developmental considerations:

  • Zebrafish adaptive immunity develops later (4-6 weeks post-fertilization)

  • Innate immunity is functional from early embryonic stages

  • Experimental timing must account for immune system maturation

  • Consider using both larval models (for innate immunity) and adult models (for complete immune responses)

2. Infection and inflammation models:

a) Pathogen challenge systems:

  • Bacterial infection models (e.g., Mycobacterium marinum, Vibrio species)

  • Viral infection models (e.g., SVCV)

  • Standardize inoculum size, route of infection, and monitoring parameters

b) Sterile inflammation models:

  • Tail fin injury for localized inflammation

  • Chemical inducers (e.g., CuSO₄ exposure)

  • Heat-killed bacteria injection

3. Molecular mechanisms assessment:

a) NEMO regulation pathway:
Based on mammalian studies in search result :

  • MARCH2 mediates K48-linked polyubiquitination of NEMO at lysine 326

  • This targets NEMO for proteasomal degradation

  • MARCH2-deficient cells show enhanced cytokine production

  • Verify conservation of this pathway in zebrafish

b) Experimental approaches:

  • Generate zebrafish MARCH2-deficient models (knockdown/knockout)

  • Measure NF-κB activation using transgenic reporter lines

  • Analyze protein levels and ubiquitination status of NEMO

  • Assess cytokine production following immune challenge

4. Immune cell analysis:

a) Cell-specific markers and transgenic lines:

Immune Cell TypeTransgenic LineMarkers for Antibody Staining
NeutrophilsTg(mpx:GFP)Mpx, Lyz
MacrophagesTg(mpeg1:GFP)Mpeg1, Marco
T cellsTg(lck:GFP)Lck, CD4, CD8
B cellsTg(rag2:GFP)IgM, Pax5

b) Functional assays:

  • Phagocytosis assays using fluorescent particles

  • Migration assays following tailfin injury

  • ROS production measurement

  • Cytokine expression analysis

5. Systems-level analysis:

a) Transcriptomics approaches:

  • RNA-seq of whole embryos or FACS-sorted immune cells

  • Compare expression profiles of wild-type versus MARCH2-deficient fish

  • Pathway analysis focusing on immune signaling networks

b) Proteomics strategies:

  • Analyze ubiquitinome changes in immune cells

  • Compare protein abundances following immune challenge

  • Focus on NF-κB pathway components based on mammalian studies

6. Comparative aspects:

  • Determine conservation of immune regulatory functions between zebrafish and mammalian MARCH2

  • Consider evolutionary adaptations in immune responses

  • Validate key findings in mammalian systems when possible

What techniques are available to study MARCH2's effects on protein quality control in the secretory pathway?

To investigate MARCH2's role in protein quality control within the secretory pathway, researchers can employ several specialized techniques:

1. Secretory protein trafficking analysis:

a) Pulse-chase approaches:

  • Express reporter proteins fused to photo-convertible fluorophores

  • Photo-convert proteins in specific compartments

  • Track their movement through the secretory pathway

  • Compare trafficking kinetics in wild-type versus MARCH2-deficient backgrounds

b) Cargo proteomics:

  • Isolate secretory vesicles from wild-type and MARCH2-deficient zebrafish

  • Perform mass spectrometry to identify cargo differences

  • Focus on ERGIC3-dependent cargo proteins like α1-antitrypsin and haptoglobin

2. Misfolded protein response assessment:

a) ER stress indicators:

  • Monitor expression of ER stress markers (BiP, CHOP, XBP1 splicing)

  • Assess activation of unfolded protein response (UPR) pathways

  • Determine if MARCH2 deficiency alters ER stress responses

b) Aggregation assays:

  • Express aggregation-prone proteins in secretory pathway

  • Analyze their fate in presence/absence of MARCH2

  • Use fluorescent protein fusions to visualize aggregation

3. Specialized imaging approaches:

a) High-resolution microscopy:

  • Super-resolution imaging of secretory compartments

  • Colocalization analysis of MARCH2 with quality control machinery

  • Live cell imaging to track protein movements in real-time

b) Correlative light and electron microscopy:

  • Visualize ultrastructural changes in secretory organelles

  • Assess morphological alterations in MARCH2-deficient cells

4. Biochemical fractionation:

a) Organelle isolation:

  • Separate ER, ERGIC, Golgi, and other compartments

  • Analyze distribution of cargo proteins across compartments

  • Compare fractionation profiles between wild-type and MARCH2-manipulated samples

b) Detergent resistance assays:

  • Assess protein aggregation through detergent solubility

  • Compare profiles in presence/absence of MARCH2

5. ERGIC3-focused approaches:

Based on search result , MARCH2 regulates ERGIC3 which functions as a cargo receptor:

a) ERGIC3 ubiquitination analysis:

  • Generate transgenic zebrafish expressing wild-type or K6R/K8R ERGIC3 variants

  • Assess effects on cargo protein trafficking and secretion

  • Determine if ubiquitination-resistant ERGIC3 mimics MARCH2 deficiency

b) Cargo binding assays:

  • Identify proteins that interact with ERGIC3 in zebrafish

  • Determine how MARCH2-mediated regulation affects these interactions

  • Use proximity labeling approaches to identify the ERGIC3 interactome

6. Functional secretion assays:

a) In vivo secretion measurements:

  • Generate transgenic lines with secreted luciferase or fluorescent reporters

  • Quantify secretion in live embryos

  • Compare wild-type, MARCH2-deficient, and rescue conditions

b) Protein quality assessment:

  • Analyze glycosylation patterns of secreted proteins

  • Assess folding status using conformation-specific antibodies

  • Measure enzymatic activity of secreted enzymes

How can emerging technologies be applied to advance MARCH2 research in zebrafish models?

Several cutting-edge technologies can significantly enhance MARCH2 research in zebrafish, opening new avenues for understanding its function:

1. Advanced genome editing approaches:

a) Base editing and prime editing:

  • Create precise point mutations in MARCH2 without double-strand breaks

  • Generate subtle modifications in regulatory regions

  • Introduce specific mutations in substrate recognition domains

b) Conditional approaches:

  • Create tissue-specific and temporally controlled MARCH2 knockout models

  • Implement inducible systems for acute MARCH2 manipulation

  • Develop switchable degron systems for rapid protein depletion

2. Single-cell multi-omics integration:

a) Single-cell transcriptomics:

  • Profile gene expression changes in MARCH2-deficient zebrafish at single-cell resolution

  • Identify cell populations most affected by MARCH2 manipulation

  • Apply trajectory analysis to understand developmental effects

b) Single-cell proteomics:

  • Analyze protein abundance changes with cellular resolution

  • Focus on membrane protein dynamics in MARCH2-deficient cells

c) Spatial transcriptomics:

  • Map gene expression changes while preserving spatial context

  • Identify local signaling environments affected by MARCH2

3. Advanced protein interaction and modification analysis:

a) Proximity labeling technologies:

  • Express MARCH2-BioID/TurboID/APEX2 fusions in zebrafish

  • Map the local proteome around MARCH2 in different cellular compartments

  • Compare interactomes across tissues and developmental stages

b) Deep mutational scanning:

  • Systematically mutate MARCH2 and assess functional consequences

  • Identify critical residues for various functions and interactions

  • Map substrate recognition determinants

4. High-throughput phenotypic screening:

a) Automated zebrafish phenotyping:

  • Use deep learning-based behavioral pattern recognition for MARCH2 mutants

  • Implement computer vision to quantify subtle developmental phenotypes

  • Apply high-content imaging for subcellular feature extraction

b) Combinatorial genetic screens:

  • Test interactions between MARCH2 and other genes

  • Perform CRISPR screens in zebrafish to identify genetic modifiers

  • Combine with small molecule libraries to identify chemical suppressors

5. Organoid and ex vivo approaches:

a) Zebrafish-derived organoids:

  • Generate tissue-specific organoids from wild-type and MARCH2-deficient zebrafish

  • Compare development, architecture, and function

  • Test specific hypotheses in controlled ex vivo environment

b) Explant cultures:

  • Maintain tissue explants for high-resolution imaging

  • Perform acute manipulations and live imaging

  • Test drug responses in native tissue architecture

6. Computational approaches:

a) Molecular dynamics simulations:

  • Model MARCH2 structure and interactions with substrates

  • Predict effects of mutations on binding and activity

  • Design improved experimental tools based on structural insights

b) Network analysis and systems biology:

  • Integrate multi-omics data to build comprehensive regulatory networks

  • Identify key nodes and potential intervention points

  • Model system behavior under different conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.