Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH4 (41337)

What is the molecular function of Danio rerio E3 ubiquitin-protein ligase MARCH4?

Danio rerio E3 ubiquitin-protein ligase MARCH4 belongs to the membrane-associated RING-CH (MARCH) family of proteins that function as E3 ubiquitin ligases. This enzyme catalyzes the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to specific substrate proteins, marking them for degradation via the 26S proteasome pathway or altering their cellular localization and function . The MARCH4 protein contains a RING-CH domain that is essential for its ubiquitin ligase activity, allowing it to participate in protein quality control, particularly for membrane-associated proteins .

In zebrafish, MARCH4 shares functional similarities with mammalian homologs and plays a role in the regulation of protein turnover, particularly in neuronal tissues. The protein's activity is critical for maintaining cellular homeostasis by facilitating the removal of misfolded or damaged proteins, thereby preventing their accumulation which could otherwise lead to cellular dysfunction .

What is the optimal storage protocol for Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH4?

For optimal preservation of enzymatic activity, storage conditions should be carefully maintained according to the protein form. The lyophilized form maintains stability for up to 12 months when stored at -20°C/-80°C, while the liquid form has a reduced shelf life of approximately 6 months under the same conditions . It is critical to note that repeated freeze-thaw cycles significantly compromise protein integrity and catalytic activity.

For working protocols, researchers should prepare small aliquots immediately after reconstitution to minimize freeze-thaw events. These working aliquots can be safely stored at 4°C for up to one week without significant loss of enzymatic function . For reconstitution, follow this evidence-based protocol:

• Centrifuge the vial briefly before opening to ensure all material is at the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended as the standard concentration)

• Prepare multiple small-volume aliquots for long-term storage at -20°C/-80°C

How does the structure of Danio rerio MARCH4 compare to mammalian orthologs?

Danio rerio MARCH4 exhibits significant structural conservation with its mammalian counterparts, particularly in the functional domains critical for ubiquitin ligase activity. The protein contains the characteristic RING-CH domain (C4HC3-type zinc finger motif) essential for E2 enzyme interaction and ubiquitin transfer . The amino acid sequence includes the critical cysteine and histidine residues that coordinate zinc ions and maintain the structural integrity of the RING domain.

The zebrafish MARCH4 protein sequence (UniProt No. Q0P496) demonstrates conserved features including:

• The RING-CH domain containing the zinc-coordinating residues

• Transmembrane domains that anchor the protein to cellular membranes

• Cytoplasmic regions involved in substrate recognition and binding

The partial amino acid sequence includes key functional regions: "RRPMLRRQGKQKGRCCVLFSDLEVFLLRPPTPSASPPAFTPMNELNAEGNATSATESHS LANGHYQPVTGEEALDTRGPDDWTHSVVDPPRTLDCCSSSEDCSKEKLDERLSLNSCTDS GVRTPLCRICFQGPEQGELLSPCRCSGSVRCTHEPCLIKWISERGSWSCELCYYKYQVIA ISTKNPLQWQAISLTVIEKVQIAAAVLGSLFLIASISWLVWSSLSPSAKWQRQDLLFQIC YAMYGFMDLVCIALIVHEGPSVFRIFNRWQAVNQQWKVLNYDKVKDNEDHQKTGATFRTL SLPLTHRMGQSGPEGEPSTSTSSLMAAAAAAAAGTVTPTTNSVPPAAGATTEPQDSSEPS NGQPSLPDHHCAYNILHLLSHLRQQEPRGQTSNSNRELVMRVTTV"

This level of conservation suggests functional similarity between zebrafish and mammalian MARCH4 proteins, supporting the use of Danio rerio as a model organism for investigating MARCH4-mediated ubiquitination processes relevant to human biology and disease.

What experimental approaches can be used to study substrate specificity of Danio rerio MARCH4?

To effectively investigate MARCH4 substrate specificity in zebrafish models, researchers should employ a multi-faceted approach combining in vitro and in vivo techniques:

• Co-immunoprecipitation (Co-IP) assays: This approach allows identification of physical interactions between MARCH4 and potential substrate proteins. Using antibodies against tagged recombinant MARCH4 (>85% purity as verified by SDS-PAGE), researchers can pull down protein complexes from zebrafish tissue lysates and identify binding partners through mass spectrometry .

• In vitro ubiquitination assays: Reconstitute the ubiquitination cascade using purified components including E1 (ubiquitin-activating enzyme), appropriate E2 (ubiquitin-conjugating enzyme), recombinant MARCH4, ATP, and candidate substrate proteins. The formation of polyubiquitin chains on substrates can be detected by western blot analysis using anti-ubiquitin antibodies .

• Proximity-dependent biotin identification (BioID): By fusing a promiscuous biotin ligase to MARCH4, researchers can biotinylate proteins in close proximity to MARCH4 in living cells. After cell lysis and streptavidin pulldown, biotinylated proteins can be identified by mass spectrometry to reveal the MARCH4 interactome .

• CRISPR/Cas9-mediated gene editing: Generating zebrafish MARCH4 mutants, particularly targeting the RING-CH domain (similar to the approach used for CHIP protein in zebrafish), enables in vivo assessment of substrate accumulation. Comparison of protein levels in wild-type versus mutant fish can identify potential MARCH4 substrates .

• Quantitative proteomics: Stable Isotope Labeling with Amino acids in Cell culture (SILAC) or Tandem Mass Tag (TMT) labeling can be used to compare protein abundance and ubiquitination levels between wild-type and MARCH4-deficient zebrafish tissues, revealing potential substrates on a proteome-wide scale .

When analyzing MARCH4 substrate specificity, it's crucial to validate findings across multiple experimental approaches to establish biological relevance and rule out technical artifacts.

How can neurodevelopmental phenotypes be assessed in zebrafish models with MARCH4 mutations?

Evaluating neurodevelopmental consequences of MARCH4 dysfunction requires comprehensive behavioral, anatomical, and molecular analyses:

• Behavioral assays: Implement standardized tests to assess neurological function, including:

  • Novel tank diving test to evaluate anxiety-like behavior

  • Light/dark preference test for anxiety assessment

  • Startle response analysis for sensorimotor integration

  • Social interaction assays to detect social behavior deficits

  • Learning and memory tests using conditioned responses

These behavioral paradigms should be quantified using automated tracking systems to minimize experimenter bias .

• Neuroanatomical analysis: Employ advanced imaging techniques to assess structural changes:

  • Confocal microscopy of transgenic lines expressing fluorescent markers in specific neuronal populations

  • Immunohistochemical staining for neuronal markers (similar to Purkinje cell analysis in CHIP studies)

  • Electron microscopy to evaluate synapse density and ultrastructure

  • Whole-brain imaging using light sheet microscopy

Quantitative analysis should include measurements of neuronal cell body size, dendritic arborization patterns, and axonal projections .

• Molecular assays: Implement techniques to assess molecular consequences:

  • RNA-seq to identify transcriptome changes in relevant brain regions

  • Proteomic analysis to identify accumulated substrates

  • Measurement of 26S proteasome activity in brain tissue

  • In situ hybridization to determine spatial expression patterns of MARCH4

The assessment should include analysis across developmental stages from embryonic to adult, as MARCH4 may have stage-specific functions .

A comprehensive example from related research shows that mutations in the U-box domain of the CHIP E3 ligase led to specific changes in Purkinje neurons including "reduced numbers and sizes of Purkinje cell bodies and abnormal organization of Purkinje cell dendrites," along with "decreased total 26S proteasome activity in the brain" and behavioral changes including "altered pattern of explorative behavior associated with reduced anxiety" . Similar multidisciplinary approaches should be applied when studying MARCH4 mutations.

What is the relationship between MARCH4 and other E3 ubiquitin ligases in zebrafish models?

The functional interplay between MARCH4 and other E3 ubiquitin ligases in zebrafish reveals a complex regulatory network governing protein homeostasis:

• Complementary and compensatory mechanisms: Research suggests that E3 ligases with similar substrate specificities may partially compensate for one another's function. Evidence from studies on CHIP (another E3 ligase) demonstrates that while complete loss of function produces severe phenotypes, partial loss of function may be mitigated by compensatory activity from other E3 ligases . When investigating MARCH4 function, researchers should consider potential functional redundancy with other MARCH family members (MARCH1-11) and additional E3 ligases.

• Pathway integration: MARCH4 likely functions within a broader network of E3 ligases that coordinate protein quality control in specific cellular compartments. For transmembrane and secretory pathway proteins, MARCH4 may cooperate with ER-associated degradation (ERAD) components and other membrane-associated E3 ligases .

• Substrate competition and cooperation: Different E3 ligases may target the same substrate under different conditions or in different cellular compartments. For example, while CHIP primarily targets cytosolic and misfolded proteins for degradation, MARCH4 focuses on membrane proteins, potentially creating a comprehensive quality control system .

• Developmental timing: Expression patterns of E3 ligases vary during zebrafish development. stub1 (encoding CHIP) shows highest expression in brain, eggs, and testes, with particularly strong expression in cerebellar Purkinje and granular layers . Similar tissue-specific and developmental expression patterns may exist for MARCH4, suggesting specialized functions in certain tissues or developmental stages.

• Pathological implications: Mutations in the functional domains of E3 ligases can lead to neurodevelopmental phenotypes. For instance, truncation of the CHIP U-box domain resulted in impaired ubiquitin ligase activity, Purkinje cell abnormalities, and behavioral changes in zebrafish . Similar functional deficiencies in MARCH4 might contribute to developmental or neurodegenerative conditions.

When designing experiments to investigate MARCH4's relationship with other E3 ligases, researchers should consider double knockout/knockdown studies, comparative substrate analyses, and tissue-specific expression profiling to delineate unique and overlapping functions.

What methodological considerations are important for in vitro ubiquitination assays using Recombinant Danio rerio MARCH4?

Conducting successful in vitro ubiquitination assays with Recombinant Danio rerio MARCH4 requires careful optimization of several critical parameters:

• Protein preparation and quality control:

  • Ensure high purity of recombinant MARCH4 (>85% as verified by SDS-PAGE)

  • Verify protein integrity through western blotting with specific antibodies

  • Assess proper folding through circular dichroism or limited proteolysis

  • Determine protein concentration accurately using methods compatible with the storage buffer components (50% glycerol in Tris-based buffer)

• Reaction components optimization:

  • E1 enzyme: Use 50-100 nM of purified ubiquitin-activating enzyme

  • E2 enzyme: Test multiple E2 enzymes (UbcH5 family members are common partners for RING-type E3 ligases)

  • Ubiquitin: Use 10-50 μM of purified ubiquitin (consider using tagged ubiquitin for easier detection)

  • ATP regeneration system: Include 5 mM ATP, 10 mM creatine phosphate, and 3.5 U/mL creatine kinase

  • Buffer conditions: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 2 mM DTT at 30°C

• Controls and validation:

  • Negative controls: Omit individual components (E1, E2, ATP, substrate) in separate reactions

  • Positive controls: Include a well-characterized E3 ligase with known activity

  • MARCH4 mutant: Generate a RING domain mutant (similar to U-box truncation in CHIP studies) as a negative control

  • Time course analysis: Sample the reaction at multiple time points (0, 15, 30, 60 minutes) to track ubiquitination kinetics

• Substrate considerations:

  • Known substrates: When available, use validated substrates from mammalian MARCH4 studies

  • Candidate approach: Test putative substrates based on protein interaction data

  • Optimization: Vary substrate concentration to determine optimal enzyme:substrate ratio

• Detection methods:

  • Western blotting: Detect ubiquitinated products using anti-ubiquitin antibodies

  • Fluorescence-based assays: Consider FRET-based systems for real-time monitoring

  • Mass spectrometry: For identification of ubiquitination sites and chain topology

A notable technical consideration is that recombinant MARCH4 is produced using the Baculovirus expression system , which provides proper eukaryotic post-translational modifications. This expression system may be critical for maintaining the native conformation and activity of the enzyme compared to bacterial expression systems.

How can CRISPR/Cas9 technology be used to generate zebrafish models for studying MARCH4 function?

Creating effective zebrafish models for MARCH4 functional studies requires strategic application of CRISPR/Cas9 genome editing:

• Target selection and guide RNA design:

  • Target the RING-CH domain, which is essential for E3 ligase activity

  • Design multiple sgRNAs targeting conserved regions using zebrafish-specific CRISPR design tools

  • Evaluate potential off-target effects using genomic databases

  • Consider targeting early exons to maximize the likelihood of functional disruption

Drawing from successful approaches in related E3 ligase studies, researchers should aim to create mutations that result in truncation of functional domains, similar to the truncation of the U-box domain in CHIP protein studies .

• Injection and founder screening protocol:

  • Microinject 1-cell stage embryos with a mixture containing:

    • 300 ng/μL Cas9 protein

    • 50 ng/μL sgRNA

    • 0.05% phenol red in nuclease-free water

  • Raise injected embryos to adulthood (F0 founders)

  • Screen F0 fish for germline transmission by outcrossing with wild-type fish

  • Identify F1 heterozygotes through fin clip genotyping

• Mutation validation and characterization:

  • Sequence targeted regions to confirm mutations

  • Verify loss of MARCH4 expression/function through:

    • RT-PCR and qPCR for mRNA expression

    • Western blotting for protein expression

    • In vitro ubiquitination assays to confirm loss of enzymatic activity

• Experimental design considerations:

  • Generate multiple mutant lines with different mutation types (frameshift, in-frame deletion)

  • Create domain-specific mutations to analyze the function of different protein regions

  • Consider generating conditional knockouts using Cre-loxP systems for tissue-specific analyses

  • Develop reporter lines by knocking in fluorescent tags to visualize MARCH4 expression patterns

For comprehensive phenotypic analysis, researchers should establish stable homozygous lines (F3 or later) and compare them with wild-type siblings under standardized conditions to minimize background effects, following approaches demonstrated in studies of other E3 ligases in zebrafish .

What is the expression pattern of MARCH4 during zebrafish development and in adult tissues?

The temporal and spatial expression pattern of MARCH4 provides critical insights into its biological functions throughout zebrafish development:

• Developmental expression timeline:
  While specific data for MARCH4 is limited in the search results, approaches used for studying related E3 ligases like CHIP (stub1) can be applied. Analysis should include qPCR and in situ hybridization at key developmental stages:

  • Early cleavage (0-3 hpf): To assess maternal contribution

  • Gastrulation (5-10 hpf): During formation of germ layers

  • Segmentation (10-24 hpf): During organogenesis

  • Hatching period (48-72 hpf): As organ systems become functional

  • Larval stages (4-30 dpf): During refinement of neural circuits

  • Juvenile to adult transition

• Tissue-specific expression in adults:
  Based on patterns observed with other E3 ligases in zebrafish, MARCH4 expression should be analyzed across multiple tissues. The related E3 ligase CHIP showed "highest expression in brain, eggs, and testes" . For MARCH4, researchers should prioritize analysis of:

  • Brain regions, particularly cerebellum (including Purkinje cell and granular layers)

  • Reproductive tissues (eggs, testes)

  • Liver and kidney (major organs for protein turnover)

  • Muscle and heart (tissues with high protein quality control demands)

  • Sensory organs (eyes, lateral line)

• Subcellular localization:
  As a membrane-associated RING-CH protein, MARCH4 is expected to localize to cellular membranes. Studies should employ:

  • Immunohistochemistry with anti-MARCH4 antibodies

  • Transgenic lines expressing fluorescently tagged MARCH4

  • Co-localization studies with markers for cellular compartments (ER, Golgi, plasma membrane)

• Expression regulation:
  Analysis of the factors regulating MARCH4 expression should include:

  • Promoter analysis to identify transcription factor binding sites

  • Response to cellular stresses (heat shock, oxidative stress)

  • Changes during aging or in disease models

For comprehensive analysis, researchers should combine whole-mount in situ hybridization for spatial mapping with qPCR for quantitative assessment across tissues and developmental stages, similar to the approach used for characterizing stub1 expression in zebrafish .

How does disruption of MARCH4 function affect protein homeostasis in zebrafish neurons?

Perturbation of MARCH4 activity likely creates cascading effects on neuronal protein homeostasis, with implications for cellular function and survival:

• Alterations in substrate protein levels:
  Disruption of MARCH4 E3 ligase function would be expected to result in accumulation of its substrate proteins. Research on the related E3 ligase CHIP revealed that loss of functional domains led to impaired ubiquitination of substrates . For MARCH4, researchers should evaluate:

  • Accumulation of transmembrane proteins that are normal MARCH4 substrates

  • Changes in receptor turnover and signaling pathway activation

  • Altered cell surface protein composition affecting neuronal function

• Impact on proteasome activity:
  Studies of CHIP mutant zebrafish revealed "decreased total 26S proteasome activity in the brain" . Similar analysis for MARCH4 mutants should include:

  • Measurement of 20S and 26S proteasome activities using fluorogenic peptide substrates

  • Quantification of proteasome subunit expression levels

  • Assessment of ubiquitin pool dynamics (free vs. conjugated ubiquitin)

• Neuronal morphology and connectivity:
  The CHIP U-box domain truncation resulted in "reduced numbers and sizes of Purkinje cell bodies and abnormal organization of Purkinje cell dendrites" . For MARCH4, researchers should examine:

  • Dendritic arborization patterns using Golgi staining or fluorescent reporters

  • Synapse density and morphology through electron microscopy

  • Axonal projections and network connectivity using neuronal tracers

• Functional consequences:
  CHIP mutant zebrafish displayed "behavioral changes" including "altered pattern of explorative behavior associated with reduced anxiety" . Similar behavioral assays should be conducted for MARCH4 mutants to assess:

  • Motor coordination and cerebellar function

  • Learning and memory performance

  • Social behaviors and anxiety-related responses

  • Sensory processing capabilities

• Cellular stress responses:
  Disruption of ubiquitin-mediated protein degradation typically activates cellular stress pathways. Analysis should include:

  • Markers of ER stress (BiP, CHOP, XBP1 splicing)

  • Activation of the unfolded protein response

  • Evidence of oxidative stress and mitochondrial dysfunction

  • Induction of autophagy as a compensatory mechanism

For comprehensive analysis, researchers should combine biochemical assays of protein homeostasis with morphological and functional studies of neuronal populations in both developing and adult zebrafish, focusing particularly on brain regions with high MARCH4 expression .

How does zebrafish MARCH4 function compare to mammalian MARCH4 in neurodevelopmental contexts?

Comparative analysis reveals important evolutionary conservation and divergence between zebrafish and mammalian MARCH4 function:

This comparative approach provides crucial context for translating findings from zebrafish MARCH4 studies to mammalian systems and ultimately to human health applications.

What methodological approaches can be used to analyze changes in the zebrafish brain proteome following MARCH4 disruption?

Comprehensive proteomic analysis of MARCH4 dysfunction requires integration of multiple methodological approaches:

• Sample preparation optimization:

  • Microdissection of specific brain regions of interest

  • Subcellular fractionation to enrich for membrane proteins (likely MARCH4 substrates)

  • Protein extraction using detergents compatible with downstream applications

  • On-bead digestion approaches for enhanced peptide recovery

  • FASP (Filter-Aided Sample Preparation) for samples with high lipid content

• Quantitative proteomics approaches:

  • TMT (Tandem Mass Tag) labeling: Enables multiplexed comparison of up to 16 samples

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture): For in vitro studies

  • Label-free quantification: For broader coverage without labeling constraints

  • Selected/Multiple Reaction Monitoring (SRM/MRM): For targeted analysis of specific proteins

• Specialized analyses for ubiquitinated proteins:

  • Enrichment of ubiquitinated proteins using tandem ubiquitin binding entities (TUBEs)

  • Antibody-based pulldown of proteins with K48 vs. K63 polyubiquitin chains

  • Identification of ubiquitination sites using GG-remnant antibodies

  • Quantification of ubiquitin chain topologies using specialized mass spectrometry approaches

• Membrane proteome analysis:

  • Cell surface protein biotinylation followed by streptavidin pulldown

  • Glycoprotein enrichment using lectin affinity chromatography

  • Phase separation techniques for membrane protein enrichment

  • Special detergent strategies for integral membrane protein solubilization

• Integrative analysis approaches:

  • Pathway enrichment analysis of differentially abundant proteins

  • Protein interaction network construction and analysis

  • Integration with transcriptomics data to identify post-transcriptional regulation

  • Temporal analysis across development or in response to stressors

• Validation strategies:

  • Western blotting for key proteins identified in proteomic screens

  • Immunohistochemistry to assess spatial distribution of accumulated substrates

  • Functional assays to determine consequences of protein accumulation

Based on approaches used in studies of other E3 ligases, researchers should particularly focus on cerebellar regions where related proteins like CHIP show high expression and where disruption leads to observable phenotypes such as Purkinje cell abnormalities . The integration of these methodologies would provide a comprehensive view of how MARCH4 dysfunction affects the brain proteome, particularly the membrane protein landscape.

What are the key considerations for designing a comprehensive research program on Danio rerio MARCH4?

Developing a robust research program for investigating Danio rerio MARCH4 requires strategic integration of multiple approaches and careful consideration of technical challenges:

• Foundational characterization:

  • Complete genetic characterization of zebrafish MARCH4, including promoter analysis

  • Comprehensive expression profiling across tissues and developmental stages

  • Development of specific antibodies and reporter lines for MARCH4 visualization

  • Biochemical characterization of enzymatic activity and substrate specificity

• Genetic model development:

  • Generation of multiple MARCH4 mutant lines targeting different functional domains

  • Creation of conditional and tissue-specific knockout models

  • Development of transgenic lines for controlled overexpression

  • Generation of humanized zebrafish lines expressing human MARCH4 variants

• Multi-level phenotypic analysis:

  • Molecular: Proteomic and transcriptomic profiling of wildtype vs. mutant tissues

  • Cellular: Analysis of cell morphology, protein localization, and subcellular structures

  • Tissue: Histological examination of affected tissues, particularly in the nervous system

  • Organismal: Behavioral testing, viability assessment, and developmental milestone analysis

• Integration with human disease research:

  • Correlation of zebrafish phenotypes with human conditions linked to E3 ligase dysfunction

  • Testing of human MARCH4 variants in zebrafish rescue experiments

  • Drug screening using MARCH4 mutant lines as disease models

  • Investigation of potential compensatory mechanisms that could inform therapeutic approaches

• Technical and experimental considerations:

  • Standardization of housing conditions to minimize environmental variables

  • Use of appropriate controls, including wild-type siblings from the same clutch

  • Blinded assessment of phenotypes to prevent observer bias

  • Sufficient sample sizes determined by power analysis

  • Validation of key findings using complementary methodologies

• Collaborative approach:

  • Integration of expertise across disciplines (genetics, biochemistry, neuroscience)

  • Utilization of specialized facilities for behavioral testing and imaging

  • Sharing of resources and standardized protocols with the research community

  • Deposition of new lines and tools in established repositories

By addressing these considerations, researchers can establish a comprehensive program that advances understanding of MARCH4 function in normal development and disease contexts, potentially leading to translational applications for human health .

How can findings from zebrafish MARCH4 studies inform therapeutic approaches for human protein quality control disorders?

Zebrafish models of MARCH4 dysfunction provide valuable translational insights that can guide therapeutic development for human protein quality control disorders:

• Target identification and validation:

  • Identification of key MARCH4 substrates that accumulate in mutant models can reveal potential therapeutic targets

  • Comparative analysis with human pathologies can validate the relevance of these targets

  • Genetic interaction studies can identify modifier genes that ameliorate phenotypes, suggesting compensatory pathways for therapeutic targeting

  • Temporal requirement studies can define critical windows for intervention

• Drug discovery applications:

  • High-throughput phenotypic screening using MARCH4 mutant zebrafish

  • Testing of compounds that enhance alternative degradation pathways

  • Evaluation of small molecules that stabilize E3 ligase function

  • Screening for drugs that improve general proteostasis capacity

• Gene therapy approaches:

  • Testing delivery methods for MARCH4 gene replacement therapy

  • Evaluation of gene editing approaches to correct specific mutations

  • Assessment of overexpression of compensatory E3 ligases

  • Development of regulatable expression systems for precise therapeutic control

• Biomarker development:

  • Identification of protein or metabolite signatures associated with MARCH4 dysfunction

  • Validation of these signatures in accessible human samples

  • Development of imaging approaches to monitor protein aggregation in vivo

  • Longitudinal studies to identify early biomarkers of disease progression

• Precision medicine strategies:

  • Correlation of specific MARCH4 mutations with distinct phenotypic outcomes

  • Testing mutation-specific therapeutic approaches

  • Investigation of genetic modifiers that influence disease penetrance and severity

  • Development of patient-specific zebrafish avatars for personalized therapeutic testing

The zebrafish model offers particular advantages for these translational applications, including:

• Rapid development and high fecundity allowing large-scale screening

• Optical transparency enabling in vivo imaging of protein dynamics

• Conserved organ systems including the brain and nervous system

• Ease of genetic manipulation for creating disease models

By leveraging these advantages, zebrafish MARCH4 studies can significantly accelerate the development of therapeutic approaches for human disorders related to E3 ligase dysfunction and broader protein quality control deficiencies.