Recombinant Danio rerio E3 ubiquitin-protein ligase Mdm2 (mdm2)

What is Mdm2 and what is its primary function in Danio rerio?

Mdm2 (Mouse double minute 2 homolog) in Danio rerio is an E3 ubiquitin ligase that plays a critical role in protein regulation through the ubiquitination pathway. Similar to its mammalian counterpart, zebrafish Mdm2 primarily regulates Tp53 (p53) levels by mediating its ubiquitination, which targets the protein for proteasomal degradation . This creates an autoregulatory feedback loop where Tp53 can bind to upstream regulatory elements of the mdm2 gene to activate its transcription . In zebrafish, this Mdm2-p53 regulatory axis has been demonstrated to be particularly important during cardiac regeneration processes, where Mdm2-mediated suppression of Tp53 promotes cardiomyocyte proliferation .

What is the domain structure of recombinant Danio rerio Mdm2 protein?

The recombinant Danio rerio Mdm2 protein (AA 1-445) contains several functional domains that are conserved across species . The protein structure includes:

• N-terminal p53-binding domain (approximately AA 1-100)

• Central acidic domain containing nuclear localization and export signals

• Zinc-finger domain

• C-terminal RING finger domain (approximately AA 400-445)

The C-terminal RING domain is particularly important as it contains the E3 ligase catalytic activity responsible for ubiquitination . This domain forms the core of Mdm2's enzymatic function and is characterized by a C₃HC₄ zinc-binding motif that is evident in the sequence "CLEPVICQSRPKNGCIVHGRTGHLMACYTCAKKLKNRNKLCPVC" toward the C-terminus of the protein .

How can recombinant Danio rerio Mdm2 be used in developmental biology research?

Recombinant Danio rerio Mdm2 can be utilized in multiple experimental approaches within developmental biology:

Methodological applications:

• Protein-protein interaction studies: Recombinant Mdm2 can be used in pull-down assays or co-immunoprecipitation experiments to identify binding partners in zebrafish development . This is particularly valuable for understanding the Mdm2-Tp53 regulatory network.

• In vitro ubiquitination assays: Purified recombinant Mdm2 can be combined with E1, E2 enzymes, ubiquitin, and potential substrate proteins to assess its E3 ligase activity and substrate specificity .

• Structure-function analysis: Site-directed mutagenesis of recombinant Mdm2 followed by functional assays can help map critical residues for its activity. For instance, mutations in the RING domain can help determine residues essential for E2 enzyme recruitment .

• Antibody production and validation: The recombinant protein can serve as an antigen for generating specific antibodies against zebrafish Mdm2, which are essential tools for studying its expression and localization during development .

What are the recommended experimental conditions for working with recombinant Danio rerio Mdm2 in vitro?

When working with recombinant Danio rerio Mdm2 in vitro, researchers should consider the following experimental conditions:

Buffer composition:

• For storage: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, 1 mM DTT

• For activity assays: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 2 mM ATP, 0.5 mM DTT

Temperature conditions:

• Storage: -80°C for long-term; -20°C with glycerol for medium-term

• Experimental: Most assays should be conducted at 28°C to match the physiological temperature of zebrafish

Protein concentration:

• For interaction studies: 50-200 ng/μL

• For enzymatic assays: 10-50 ng/μL

Quality control parameters:

• Purity: >90% as determined by SDS-PAGE

• Activity: Verification by in vitro ubiquitination assay using Tp53 as substrate

It's important to note that the RING domain of Mdm2 can have aggregation tendencies, as observed in human Mdm2. Work with other species' RING domains or specific mutations (like G443T in human MDM2) has shown improved solubility while maintaining activity .

How does zebrafish Mdm2 differ from mammalian Mdm2 in structure and function?

Zebrafish Mdm2 shares significant homology with mammalian Mdm2, particularly in functional domains, but there are notable differences:

Research has shown that the RING domains of non-human MDM2 proteins may be less prone to aggregation while maintaining their structure and E2-binding capability . This characteristic could make zebrafish Mdm2 particularly valuable for structural and biochemical studies that are challenging with human MDM2.

What role does Mdm2 play in cardiac regeneration in zebrafish, and how can recombinant Mdm2 help study this process?

Mdm2 plays a crucial role in cardiac regeneration in zebrafish through its regulation of the tumor suppressor protein Tp53. Research has demonstrated that:

• Following cardiac injury, mdm2 expression is upregulated in regenerating cardiomyocytes .

• This upregulation leads to suppression of Tp53 levels, which removes a barrier to cardiomyocyte proliferation .

• Zebrafish lacking functional Tp53 display increased cardiomyocyte proliferation during regeneration .

• Transgenic Mdm2 blockade (using dominant-negative constructs) inhibits injury-induced cardiomyocyte proliferation .

Recombinant Mdm2 can facilitate research in this area through:

• In vitro modeling: Reconstituting the Mdm2-Tp53 regulatory system with purified components.

• Interaction screening: Identifying additional proteins that interact with Mdm2 during cardiac regeneration.

• Drug screening: Testing compounds that modulate Mdm2 activity as potential enhancers of cardiac regeneration.

• Structure-based drug design: Using the structural information from recombinant Mdm2 to design specific modulators.

This research direction is particularly valuable because understanding the Mdm2-Tp53 axis in zebrafish heart regeneration could provide insights for therapeutic approaches to human heart disease.

What are common difficulties when working with recombinant Mdm2, and how can they be resolved?

Working with recombinant Mdm2 presents several technical challenges:

• Protein solubility issues:

  • Problem: The RING domain of Mdm2 can have aggregation tendencies.

  • Solution: Consider using zebrafish Mdm2 which may have better solubility characteristics than human MDM2 . Alternatively, introducing stabilizing mutations (similar to G443T in human MDM2 ) or optimizing buffer conditions (adding 10% glycerol, 0.05% Tween-20) can improve solubility.

• E3 ligase activity preservation:

  • Problem: Loss of enzymatic activity during purification or storage.

  • Solution: Always include reducing agents (DTT or β-mercaptoethanol) in buffers to protect the zinc-coordinating cysteines in the RING domain. Consider activity assays immediately after purification to establish a baseline.

• Substrate specificity determination:

  • Problem: Identifying true physiological substrates versus in vitro artifacts.

  • Solution: Validate results using multiple approaches, including in vitro ubiquitination with proper controls, co-immunoprecipitation from zebrafish tissues, and correlative proteomics.

• Structural characterization difficulties:

  • Problem: Obtaining structural information for full-length Mdm2.

  • Solution: Consider domain-by-domain structural analysis, potentially focusing on the better-behaved domains first. The zebrafish RING domain may offer advantages for structural studies compared to human MDM2 .

How can researchers validate the specificity of morpholino knockdowns targeting mdm2 in zebrafish?

Validation of morpholino (MO) specificity is critical when targeting mdm2 in zebrafish, especially given documented issues with MO off-target effects:

• Rescue experiments: Co-inject MO with mdm2 mRNA lacking the MO binding site to determine if the phenotype can be rescued. This is the gold standard for specificity validation .

• Multiple non-overlapping MOs: Use different MOs targeting different regions of mdm2 pre-mRNA. Similar phenotypes with different MOs increase confidence in specificity .

• Comparison with genetic mutants: Compare morphant phenotypes with CRISPR/Cas9 or TALEN-generated mdm2 mutants. Discrepancies between morphant and mutant phenotypes may indicate off-target effects or genetic compensation in mutants .

• Target validation by RT-PCR: Confirm that splice-blocking MOs actually affect splicing of the target pre-mRNA by analyzing mdm2 transcripts from morphant embryos .

• Secondary target analysis: Consider deep RNA sequencing to identify potential off-target effects. Research has shown that as few as 11 consecutive complementary bases can be sufficient for MO binding and splice site blocking .

Research has shown that increasing embryo growth temperature after MO injection can reduce secondary target effects in some cases .

How is recombinant Danio rerio Mdm2 being used in current cancer and regenerative medicine research?

Recombinant Danio rerio Mdm2 is contributing to cancer and regenerative medicine research in several innovative ways:

• Cancer research applications:

  • As a model system for understanding basic Mdm2-p53 regulatory mechanisms that are often dysregulated in human cancers

  • For screening potential inhibitors of the Mdm2-p53 interaction that could have therapeutic applications

  • In comparative studies to understand the evolutionary conservation of Mdm2 function in tumor suppression

• Regenerative medicine applications:

  • Understanding the role of Mdm2 in zebrafish cardiac regeneration is providing insights into potential therapeutic targets for human heart disease

  • Research shows that Mdm2-mediated suppression of Tp53 is a regulatory component of innate cardiac regeneration

  • The discovery that mitogenic factors like Nrg1 or Vegfaa upregulate mdm2 and suppress Tp53 levels suggests potential therapeutic strategies

Key findings from recent research indicate that Mdm2 induction is spatiotemporally associated with markers of de-differentiation in both injury and growth contexts, suggesting a broad role in cardiogenesis . This has implications for potential regenerative therapies targeting the Mdm2-Tp53 axis.

What are promising approaches for studying the E3 ligase activity of Mdm2 beyond p53 regulation?

While Mdm2 is best known for regulating p53, expanding research into its broader E3 ligase activities offers promising directions:

• Substrate identification approaches:

  • Proteomics-based methods: Using techniques like BioID or APEX2 proximity labeling coupled with mass spectrometry to identify proteins in close proximity to Mdm2 in zebrafish tissues

  • Ubiquitinome analysis: Comparing the ubiquitinated proteome in wild-type versus mdm2-deficient zebrafish to identify differential ubiquitination

  • Yeast two-hybrid screening: Using zebrafish Mdm2 domains as bait to identify novel interacting partners

• Non-degradative ubiquitination:

  • Investigating how Mdm2-mediated ubiquitination may regulate protein localization, interactions, or activity without causing degradation

  • For example, research has shown that in mammals, Mdm2 can regulate nuclear export of p53 through ubiquitination in a concentration-dependent manner

• Tissue-specific roles:

  • Exploring tissue-specific functions of Mdm2 beyond cardiomyocytes, such as in neural development or regeneration

  • Using tissue-specific genetic tools to manipulate Mdm2 activity in different zebrafish tissues

• Regulation of immune responses:

  • Investigating the recently discovered role of Mdm2 in controlling T cell-mediated anti-tumor immunity through regulation of STAT5 stability

  • This could provide new perspectives on cancer immunotherapy approaches

• Interplay with other E3 ligases:

  • Studying how Mdm2 functions within the broader network of E3 ligases in zebrafish, particularly during development and regeneration

  • Examining potential redundancy or cooperation with other E3 ligases

Understanding these broader functions of Mdm2 could reveal novel therapeutic targets not only for cancer but also for regenerative medicine and inflammatory disorders.

What are the best approaches for expressing and purifying recombinant Danio rerio Mdm2 for structural studies?

Optimizing expression and purification of recombinant Danio rerio Mdm2 for structural studies requires careful consideration of several factors:

Expression systems:

• Bacterial expression (E. coli):

  • Advantages: High yield, cost-effective, rapid production

  • Strategies: Use specialized strains (BL21(DE3) pLysS, Rosetta), low temperature induction (16-18°C), fusion tags (MBP, SUMO)

  • Limitations: Potential folding issues with full-length protein

• Yeast expression (demonstrated successfully ):

  • Advantages: Better folding, some post-translational modifications

  • Systems: Pichia pastoris or Saccharomyces cerevisiae

  • Considerations: Longer production time, lower yield than bacteria

• Insect cell expression:

  • Advantages: Superior folding, post-translational modifications

  • System: Baculovirus expression in Sf9 or Hi5 cells

  • Best for: Full-length Mdm2 or difficult domains like RING

Purification strategies:

• Domain-based approach: Express individual domains separately (N-terminal p53-binding domain, central domain, RING domain)

• Affinity purification: His-tag purification followed by ion exchange and size exclusion chromatography

• Special considerations for RING domain: Include zinc in buffers (10-50 μM ZnCl₂), maintain reducing conditions

Stabilization strategies:

• Buffer optimization: 50 mM Tris-HCl pH 7.5, 150-300 mM NaCl, 10% glycerol, 1 mM DTT

• Solubility enhancement: Consider orthologous RING domains which may have better solubility properties

• Mutation approach: Strategic mutations based on comparative analysis of RING domains from different species (similar to G443T in human MDM2)

For crystallization studies specifically, producing the zebrafish Mdm2 RING domain might offer advantages over the human version, as research indicates that non-human MDM2 RING domains may be less prone to aggregation while maintaining structural and functional integrity .

How can researchers effectively design experiments to study the relationship between Mdm2 and cardiac regeneration in zebrafish?

Designing robust experiments to investigate the Mdm2-cardiac regeneration relationship requires multi-faceted approaches:

In vivo experimental approaches:

• Genetic manipulation strategies:

  • CRISPR/Cas9 knockout of mdm2 (full or conditional)

  • Transgenic overexpression systems (cmlc2:CreER; β-act2:BSmdm2)

  • Dominant-negative Mdm2 expression (e.g., RING domain mutants)

  • Tp53 mutant lines as controls/comparisons

• Injury models:

  • Ventricular resection (most common)

  • Cryoinjury (more similar to mammalian infarction)

  • Genetic ablation of cardiomyocytes

• Assessment methods:

  • BrdU/EdU incorporation to measure cardiomyocyte proliferation

  • PCNA immunostaining for proliferation markers

  • Transgenic cell cycle reporters (FUCCI)

  • Echocardiography for functional assessment

Molecular analysis approaches:

• Expression analysis:

  • RNA-seq of regenerating hearts at multiple timepoints

  • Single-cell RNA-seq to identify cell-specific responses

  • In situ hybridization for spatial localization of mdm2 expression

  • RT-qPCR for quantitative expression data

• Protein analysis:

  • Western blotting for Mdm2 and Tp53 protein levels

  • Co-immunoprecipitation to identify interacting partners

  • Ubiquitination assays to assess Mdm2 E3 ligase activity

  • Phospho-specific antibodies to assess regulatory modifications

Experimental design considerations:

• Temporal dynamics: Sample collection at multiple timepoints (1, 3, 7, 14, 30 days post-amputation)

• Controls: Include sham-operated controls and genetic controls (e.g., tp53 mutants)

• Rescue experiments: Test if phenotypes can be rescued by transgenic expression

• Mitogen stimulation: Use Nrg1 or Vegfaa overexpression to stimulate cardiomyocyte proliferation and assess Mdm2 involvement

A comprehensive experimental approach would integrate these methods to establish causality between Mdm2 activity and regenerative outcomes, potentially revealing therapeutic targets for human cardiac regeneration.