Recombinant Danio rerio E3 ubiquitin-protein ligase rnf152 (rnf152)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Danio rerio E3 ubiquitin-protein ligase rnf152 (rnf152) is an enzyme that, in humans, is encoded by the RNF152 gene . RNF152 is an E3 ubiquitin ligase, containing a RING domain and a transmembrane (TM) domain . E3 ubiquitin ligases are enzymes that facilitate the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate protein, marking the substrate for degradation or altering its function .

Function

Danio rerio is another name for zebrafish. The protein encoded by the RNF152 gene in Danio rerio is involved in several processes, including cellular response to amino acid . RNF152 acts as a negative regulator of mTORC1 signaling by mediating ubiquitination of RagA/RRAGA and RHEB . RNF152 positively regulates TLR/IL-1R-mediated inflammatory response by facilitating oligomerization of MyD88, which subsequently promotes the assembly of Myddosome . RNF152 is essential for TLR/IL-1R-mediated, MyD88-dependent signal transduction . It is a tyrosinase-specific ubiquitin ligase essential for regulating melanogenesis in melanocytes .

Research Findings

  • Regulation of Melanogenesis: RNF152 is a tyrosinase-specific ubiquitin ligase essential for regulating melanogenesis in melanocytes .

  • TLR/IL-1R Signaling: RNF152 positively regulates TLR/IL-1R-mediated inflammatory response by facilitating oligomerization of MyD88, which subsequently promotes the assembly of Myddosome . RNF152-deficient mice produce fewer inflammatory cytokines in response to LPS and are more resistant to LPS-induced lethal endotoxemia .

  • mTORC1 Signaling: RNF152 acts as a negative regulator of mTORC1 signaling by mediating ubiquitination of RagA/RRAGA and RHEB .

  • Colorectal Cancer: RNF152 inhibits colorectal cancer growth and may be a novel prognostic biomarker for the treatment of CRC . High expression levels of RNF152 correlated with better prognosis in patients with colorectal cancer, while low expression of RNF152 correlated with lymphatic metastasis . RNF152 inhibits proliferation of CRC cells by negatively regulating mTORC1 to induce autophagy and cell death .

RNF152 in Melanoma Cells

RNF152 regulates expression of tyrosinase in B16 cells . RNF152 co-localizes with tyrosinase in TGN and degrades it in lysosomes . RNF152 physically associates with tyrosinase and strongly ubiquitinates tyrosinase . RNF152 ubiquitinates Tyrp-1 to a lesser degree .

RNF152 and Inflammatory Response

RNF152 positively regulates TLR/IL-1R signaling by enhancing MyD88 oligomerization . RNF152 is involved in IL-1R/TLR4-mediated signaling . RNF152 specifically regulates TLR/IL-1R-mediated, MyD88-dependent signaling . RNF152-deficient mice produce less inflammatory cytokines in response to LPS and are more resistant to LPS-induced lethal endotoxemia .

RNF152 and Cancer

RNF152 inhibits colorectal cancer cell growth and is a potential prognostic biomarker . High expression levels of RNF152 correlated with better prognosis in patients with colorectal cancer . Overexpression of RNF152 inhibited CRC cell proliferation both in vitro and in vivo by inactivating the mechanistic target of rapamycin complex 1 (mTORC1) and inducing autophagy and apoptotic cell death .

RNF152 Expression and Prognosis in Colorectal Cancer

Table 2. Statistical analysis of the relationship between RNF152 protein expression and CRC pathological features

TissuesCases (N)Score of RNF152 expressionP
01
CRC1691967
NT169410
Stage
I1332
II66424
III711130
IV19111
Stage N
N085828
N1/2841139

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
rnf152; zgc:110537; E3 ubiquitin-protein ligase rnf152; RING finger protein 152; RING-type E3 ubiquitin transferase rnf152
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MDSLSQSSRLECQICFNYFSQRRLPKLLHCQHTCCSVCLSQMRLSQREIRCPWCRCVTQI PIGLSVSHLPDDPEVLSVISVSQSSEHTPIFIHLPNNGCYLLPVSLDTDGTPLPGQPTCH VGPKSIGVFDVSDGQNHVLGHDGLGDGMEEEEVVVVKTTAWTGVCTVLLVAFILIFLLGI VLHNMSCVSKRFTIISCG
Uniprot No.

Target Background

Function
Rnf152 is an E3 ubiquitin-protein ligase that mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation. This regulates mTORC1 signaling and influences cellular responses to amino acid availability. It also mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation.
Gene References Into Functions
  1. Rnf152 is crucial for eye, midbrain, and hindbrain development, with involvement of Delta-Notch signaling. PMID: 29276941
Database Links
Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Q&A

What is RNF152 and what are its key structural domains?

RNF152 (RING finger protein 152) is a canonical RING finger protein that functions as an E3 ubiquitin ligase. Structurally, RNF152 contains two essential domains: a RING finger domain that is critical for its E3 ligase activity and a transmembrane domain that determines its subcellular localization. The protein exhibits autoubiquitination activity in vivo, which is dependent on both domains . The RING domain contains characteristic conserved cysteine residues that coordinate zinc ions and are essential for catalytic function. Mutation of the conserved cysteine at position 30 (C30S) significantly reduces its E3 ligase activity .

Where is RNF152 primarily expressed in zebrafish embryos during development?

In zebrafish embryos, rnf152 exhibits a dynamic expression pattern during development. At 24 hours post-fertilization (hpf), rnf152 expression is ubiquitous throughout the brain. By 48 hpf, its expression becomes more restricted to specific regions including the eyes, midbrain-hindbrain boundary (MHB), and rhombomeres . This spatiotemporal expression pattern suggests that rnf152 plays crucial roles in the development of specific neural structures during embryogenesis. Whole-mount in situ hybridization (WISH) is the preferred method for visualizing this expression pattern in intact embryos .

What is the subcellular localization of RNF152?

RNF152 is predominantly localized to lysosomes, as demonstrated by co-localization studies with LAMP3, a well-established lysosomal marker . This lysosomal localization is dependent on its transmembrane domain. When this domain is disrupted or deleted, the localization pattern is altered, which affects the protein's function. The lysosomal localization of RNF152 is particularly significant as it represents the first identified E3 ligase involved in lysosome-related apoptosis. Subcellular fractionation and immunofluorescence microscopy with organelle-specific markers are effective methodologies for confirming this localization .

How does rnf152 affect neurodevelopment in zebrafish embryos?

Knockdown of rnf152 in zebrafish embryos results in significant neurodevelopmental defects, particularly in the eyes, midbrain-hindbrain boundary (MHB), and rhombomeres (r1-7) at 24 hpf. These defects have been characterized using whole-mount in situ hybridization (WISH) with various neural marker probes. Most notably, neuroD expression is abolished in multiple layers of the developing eye including the marginal zone, outer nuclear layer (ONL), inner nuclear layer (INL), and ganglion cell layer (GCL) at 27 hpf . Additionally, expression of deltaD and notch1a is remarkably reduced in the ONL, INL, subpallium, tectum, cerebellum, and rhombomeres, while notch3 expression is reduced in the tectum, cerebellum, and rhombomeres . These observations indicate that rnf152 is essential for proper neurogenesis and patterning during zebrafish embryogenesis.

What is the relationship between rnf152 and Delta-Notch signaling in zebrafish development?

Rnf152 functions as a critical regulator of Delta-Notch signaling during zebrafish embryogenesis. Knockdown studies have demonstrated that rnf152 deficiency leads to significant reductions in the expression of notch1a, notch3, and deltaD in multiple brain regions at 24 hpf . Furthermore, the expression of Notch target genes, specifically her4 and ascl1a, is also significantly decreased in these regions. This indicates that rnf152 functions upstream of the Delta-Notch signaling pathway, possibly regulating the expression or activity of Delta ligands and Notch receptors. The relationship between rnf152 and Delta-Notch signaling appears crucial for proper neurogenesis and brain development, particularly in the eyes, midbrain, and hindbrain regions .

What experimental techniques are most effective for studying rnf152 function during zebrafish embryogenesis?

To effectively study rnf152 function during zebrafish embryogenesis, researchers typically employ a combination of techniques:

  • Morpholino-mediated knockdown: Antisense morpholino oligonucleotides targeting rnf152 mRNA can be microinjected into one-cell stage embryos to reduce protein expression.

  • Whole-mount in situ hybridization (WISH): This technique allows visualization of gene expression patterns in intact embryos using antisense RNA probes for rnf152 and related developmental markers.

  • Immunohistochemistry: For protein-level analysis and localization studies.

  • Transgenic reporter lines: These can be used to visualize specific signaling pathways or cell types affected by rnf152 manipulation.

  • CRISPR/Cas9-mediated genome editing: For generating stable rnf152 mutant lines.

When analyzing the results, it's critical to examine multiple stages of development (e.g., 24 hpf, 48 hpf) and use a panel of markers for different neural structures and developmental pathways to comprehensively assess the phenotypic consequences of rnf152 manipulation .

How does RNF152 regulate TLR/IL-1R signaling pathways?

RNF152 functions as a positive regulator of Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) signaling pathways. Mechanistically, RNF152 enhances MyD88 oligomerization, which is a critical step in the formation of the Myddosome complex required for signal transduction. Overexpression of RNF152 potentiates IL-1β- and LPS-induced NF-κB activation, leading to increased inflammatory cytokine production .

Interestingly, this regulation occurs in an ubiquitination-independent manner. Despite RNF152 being an E3 ubiquitin ligase, mutants lacking E3 ligase activity (C30S or RING domain deletions) still enhance IL-1β-stimulated NF-κB activation. Instead, RNF152 directly binds to MyD88 through its C-terminal region and promotes MyD88 self-association, which is essential for signal transduction .

This function is specific to MyD88-dependent pathways, as RNF152 deficiency does not affect TRIF-dependent TLR signaling or other innate immune pathways like RIG-I-VISA or cGAS-STING signaling .

What is the role of RNF152 in inflammatory responses in vivo?

In the LPS-induced endotoxemia model, RNF152-deficient mice exhibit delayed onset of death and reduced mortality compared to wild-type counterparts. This protective effect correlates with reduced inflammatory cytokine production. These findings confirm that RNF152 specifically regulates MyD88-dependent inflammatory pathways in vivo .

The translational implications of these findings suggest that RNF152 could be a potential therapeutic target for modulating inflammatory responses in conditions characterized by excessive TLR/IL-1R signaling, such as sepsis or certain autoimmune disorders.

How does RNF152's apoptotic function relate to its lysosomal localization?

RNF152 is the first identified E3 ligase that is localized to lysosomes and involved in lysosome-related apoptosis. Overexpression of RNF152 in HeLa cells induces apoptosis, suggesting that it has pro-apoptotic activities . This function may be linked to its role in regulating lysosomal membrane integrity or function.

The lysosomal localization of RNF152 is dependent on its transmembrane domain. When this domain is disrupted, both its localization and pro-apoptotic function are affected. This suggests that the proper positioning of RNF152 at the lysosomal membrane is critical for its ability to induce apoptosis .

The exact mechanisms by which RNF152 promotes apoptosis from its lysosomal position are not fully elucidated, but may involve regulation of lysosomal membrane permeabilization, a process known to trigger cell death through the release of lysosomal enzymes into the cytosol. Alternatively, RNF152 might ubiquitinate specific protein targets at the lysosomal membrane that influence cell survival pathways.

What are the optimal conditions for expressing and purifying recombinant Danio rerio RNF152?

For optimal expression and purification of recombinant Danio rerio RNF152, researchers should consider the following protocol:

Expression System Selection:

  • E. coli systems (BL21(DE3)) are suitable for expressing the soluble domains of RNF152 (particularly the RING domain)

  • For full-length protein including the transmembrane domain, eukaryotic expression systems such as insect cells (Sf9) or mammalian cells (HEK293) yield better results due to proper membrane protein folding and post-translational modifications

Expression Parameters:

  • Temperature: 18-20°C for E. coli systems to enhance solubility

  • Induction: 0.1-0.5 mM IPTG for bacterial systems; for eukaryotic systems, optimized viral titers or transfection conditions

  • Duration: 16-20 hours post-induction for optimal yield while minimizing degradation

Purification Strategy:

  • Lysis buffer composition: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% Triton X-100 (or other mild detergents for membrane proteins), protease inhibitor cocktail

  • Affinity chromatography: His-tag or GST-tag purification as first step

  • Size exclusion chromatography as secondary purification step

  • For membrane-bound RNF152, detergent screening (DDM, CHAPS, etc.) is essential for maintaining protein stability and activity

Activity Preservation:

  • Addition of zinc (10-50 μM ZnCl₂) in all buffers to maintain RING domain structure

  • Inclusion of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent cysteine oxidation

  • Storage in 10% glycerol at -80°C in small aliquots to minimize freeze-thaw cycles

Regular activity assays should be performed to ensure the functional integrity of the purified protein, typically using in vitro ubiquitination assays with E1, E2, and ubiquitin.

What are the most effective approaches for studying RNF152's E3 ligase activity in vitro?

Several approaches can be employed to effectively study RNF152's E3 ligase activity in vitro:

1. In Vitro Ubiquitination Assays:

  • Components: Purified E1 activating enzyme, appropriate E2 conjugating enzyme (typically UbcH5 family members), ubiquitin, ATP, recombinant RNF152, and potential substrate proteins

  • Detection: Western blotting with anti-ubiquitin antibodies or using fluorescently-labeled ubiquitin

  • Controls: Include C30S mutant as a negative control for E3 activity, and reactions without ATP as technical controls

2. E2 Screening:

  • Test multiple E2 enzymes to determine preferred pairing with RNF152

  • Typical candidates include UbcH5a-c, UbcH7, and UbcH10

  • This can provide insights into the type of ubiquitin chains that RNF152 preferentially forms

3. Ubiquitin Chain Analysis:

  • Use ubiquitin mutants (K48R, K63R, etc.) to determine the type of chains formed

  • Mass spectrometry analysis of ubiquitinated products

  • Previous studies indicate RNF152 mediates K48-linked polyubiquitination, suggesting a role in proteasomal degradation

4. Domain Mutation Analysis:

  • Compare wild-type RNF152 with C30S mutant (disrupts RING domain function)

  • Test RNF152-ΔR (deletion of RING domain) and RNF152-ΔTM (deletion of transmembrane domain)

  • These variants help dissect the contribution of each domain to E3 ligase activity

5. Substrate Identification:

  • Proximity-based labeling combined with mass spectrometry

  • Co-immunoprecipitation followed by ubiquitination assays

  • Current knowledge indicates RNF152 can ubiquitinate RagA GTPase and exhibits autoubiquitination activity

These methodologies collectively provide a comprehensive assessment of RNF152's E3 ligase activity, substrate specificity, and the type of ubiquitin modifications it catalyzes.

What technical challenges might researchers encounter when studying RNF152's role in Delta-Notch signaling?

Researchers studying RNF152's role in Delta-Notch signaling may encounter several technical challenges:

1. Spatiotemporal Resolution Challenges:

  • Delta-Notch signaling is highly dynamic and context-dependent during development

  • Solution: Implement high-resolution time-course experiments with multiple developmental stages (24 hpf, 27 hpf, 48 hpf, etc.) and use tissue-specific markers to precisely map effects

2. Knockdown Specificity and Efficiency:

  • Morpholino-based knockdown may have off-target effects or variable efficiency

  • Solution: Employ multiple independent morpholinos targeting different regions of rnf152 mRNA and validate with rescue experiments using morpholino-resistant mRNA constructs

  • Alternative: Generate CRISPR/Cas9 knockout lines to complement morpholino studies

3. Pathway Crosstalk Interference:

  • Delta-Notch signaling interacts with multiple other developmental pathways

  • Solution: Use pathway-specific inhibitors (e.g., DAPT for Notch) to dissect specific contributions and employ transgenic reporter lines for individual pathways

4. Direct vs. Indirect Effects Disambiguation:

  • Distinguishing whether RNF152 directly regulates Delta-Notch components or acts indirectly

  • Solution: Perform temporal inhibition studies using heat-shock inducible constructs or photoactivatable morpholinos to determine immediate vs. delayed effects

5. Quantification of In Situ Hybridization Data:

  • WISH results can be difficult to quantify objectively

  • Solution: Combine with qRT-PCR for Notch pathway genes (deltaD, notch1a, notch3, her4, ascl1a) from dissected tissues and implement digital image analysis with standardized protocols

6. Cellular Resolution Limitations:

  • Whole-mount approaches may lack cellular resolution

  • Solution: Employ confocal microscopy with fluorescent in situ hybridization (FISH) or immunofluorescence for cell-specific analysis

A comprehensive experimental design that addresses these challenges is essential for accurately characterizing RNF152's role in Delta-Notch signaling during zebrafish development .

How can researchers reconcile RNF152's E3 ligase activity with its ubiquitination-independent role in TLR/IL-1R signaling?

The dual functionality of RNF152—possessing E3 ligase activity while regulating TLR/IL-1R signaling in an ubiquitination-independent manner—presents an intriguing paradox that requires careful experimental design and interpretation.

To reconcile these seemingly contradictory functions, researchers should:

  • Conduct domain-specific functional studies: E3-deficient point mutations (C30S) and truncation mutants lacking the RING domain (RNF152-ΔR) still potentiate IL-1β-stimulated NF-κB activation despite showing markedly decreased autoubiquitination. This suggests the protein has scaffolding functions independent of its enzymatic activity .

  • Analyze protein-protein interactions: RNF152 directly binds to MyD88 through its C-terminal region and promotes MyD88 self-association. This binding and subsequent promotion of oligomerization appears to be the primary mechanism for enhancing TLR/IL-1R signaling, rather than ubiquitination of pathway components .

  • Perform temporal regulation studies: It's possible that RNF152's E3 ligase activity and its scaffolding function operate in different cellular contexts or temporal windows. Time-course experiments with selective inhibition of either function could help elucidate this.

  • Investigate potential substrate specificity: While RNF152 doesn't appear to ubiquitinate Myddosome components, it may ubiquitinate other proteins that indirectly affect signaling through feedback mechanisms. Comprehensive proteomics approaches can identify the complete range of RNF152 substrates.

  • Examine subcellular compartmentalization: The transmembrane domain of RNF152 is required for its ability to enhance MyD88 oligomerization in cells, suggesting that membrane association plays a critical role in its non-enzymatic functions .

This dual functionality suggests that RNF152 may have evolved to serve multiple cellular roles, with its E3 ligase activity being essential for some functions (like lysosomal apoptosis) but dispensable for others (like TLR/IL-1R signaling enhancement).

What are the potential therapeutic implications of targeting RNF152 in inflammatory diseases?

The identification of RNF152 as a positive regulator of TLR/IL-1R-mediated inflammatory responses suggests several potential therapeutic implications:

  • Inflammatory Disease Modulation: RNF152-deficient mice produce lower levels of inflammatory cytokines (IL-6, TNFα) in response to LPS and show increased resistance to LPS-induced lethal endotoxemia . This suggests that inhibiting RNF152 could potentially reduce excessive inflammation in conditions such as sepsis, inflammatory bowel disease, and autoimmune disorders.

  • Targeting Strategy Development:

    • Small molecule inhibitors that disrupt the interaction between RNF152 and MyD88 could be developed as anti-inflammatory agents

    • Since RNF152's role in TLR/IL-1R signaling is independent of its E3 ligase activity, inhibitors would need to target protein-protein interactions rather than enzymatic activity

    • Structure-based drug design based on the binding interface between RNF152 and MyD88 could yield selective inhibitors

  • Pathway Selectivity Advantages: RNF152 specifically regulates MyD88-dependent but not TRIF-dependent signaling , potentially allowing for selective modulation of certain inflammatory pathways while preserving others. This could potentially reduce side effects compared to broader immunosuppressive therapies.

  • Biomarker Development: RNF152 mRNA levels increase after LPS stimulation , suggesting it could serve as a biomarker for inflammatory activation or response to therapy.

  • Delivery Challenges: As a membrane-associated protein that functions in specific cellular compartments, developing effective delivery strategies for RNF152-targeting therapeutics would require careful consideration of subcellular targeting.

Future research should focus on developing selective RNF152 inhibitors and evaluating their efficacy in preclinical models of inflammatory diseases, while also addressing potential off-target effects related to RNF152's other cellular functions such as its role in developmental processes and apoptosis.

What are the implications of RNF152's dual roles in embryonic development and inflammatory signaling?

The dual functionality of RNF152 in embryonic development and inflammatory signaling reveals important implications for both developmental biology and immunology:

  • Evolutionary Conservation and Functional Divergence:

    • The conservation of RNF152 across species suggests fundamental biological importance

    • Its diverse roles may represent evolutionary adaptation of a core molecular scaffold to serve context-specific functions

    • Comparative studies across species could reveal how these functions diverged or converged evolutionarily

  • Developmental-Inflammatory Axis:

    • The involvement of RNF152 in both processes suggests potential developmental origins of inflammatory regulation

    • This connection may provide insights into developmental programming of immune responses

    • Research should investigate whether early developmental exposure to inflammatory stimuli affects RNF152 expression or function later in life

  • Signaling Pathway Integration:

    • RNF152 may represent a node of integration between Delta-Notch and TLR/IL-1R signaling pathways

    • Both pathways utilize RNF152 in different contexts, raising questions about shared molecular mechanisms

    • Research should examine whether RNF152's facilitation of protein oligomerization (shown for MyD88 ) might also apply to Notch pathway components

  • Methodological Considerations for Research:

    • Studies must carefully consider developmental stage and tissue context when examining RNF152 function

    • Experimental models should control for potential confounding effects between developmental and immune phenotypes

    • Tissue-specific and inducible knockout models would help dissect these distinct functions

  • Translational Implications:

    • Therapeutic targeting of RNF152 for inflammatory conditions must consider potential developmental side effects

    • Developmental phenotypes may provide insights into potential long-term consequences of RNF152 modulation

    • Age-dependent effects of RNF152 targeting should be thoroughly investigated

This dual functionality highlights the importance of comprehensive phenotyping in multiple biological contexts when studying ubiquitin ligases like RNF152, as their functions often extend beyond a single pathway or developmental process.

How should researchers design experiments to compare RNF152 function across different vertebrate species?

When comparing RNF152 function across vertebrate species, researchers should implement a systematic experimental approach that accounts for evolutionary conservation and species-specific differences:

1. Comparative Sequence and Structure Analysis:

  • Perform phylogenetic analysis of RNF152 across species (zebrafish, mouse, human, etc.)

  • Identify conserved domains (RING finger, transmembrane) and species-specific variations

  • Use homology modeling to predict structural conservation and divergence

  • Create a table of sequence identity percentages across key functional domains:

2. Expression Pattern Comparison:

  • Compare spatiotemporal expression patterns using in situ hybridization or RNA-seq data

  • Analyze expression in equivalent developmental stages across species

  • Document tissue-specific expression similarities and differences

  • Create developmental time-course expression maps for each species

3. Functional Conservation Assessment:

  • Design cross-species rescue experiments:

    • Knock down/out endogenous rnf152 in zebrafish

    • Attempt rescue with orthologs from other species (mouse, human)

    • Assess rescue efficiency through phenotypic and molecular markers

  • Evaluate conservation of protein-protein interactions:

    • Test binding of RNF152 from different species to conserved partners (MyD88, etc.)

    • Use co-immunoprecipitation or proximity ligation assays

4. Pathway Regulation Comparison:

  • Assess effects on Delta-Notch signaling across species:

    • Compare effects on notch1a, deltaD, her4, and ascl1a expression

    • Determine if developmental phenotypes are conserved

  • Evaluate TLR/IL-1R pathway regulation:

    • Compare NF-κB activation and cytokine production

    • Assess MyD88 oligomerization enhancement

5. Domain Swap Experiments:

  • Create chimeric proteins with domains from different species

  • Test which domains are responsible for species-specific functions

  • Map critical residues for conserved versus divergent functions

By implementing this comprehensive approach, researchers can determine which functions of RNF152 are evolutionarily conserved core activities versus species-specific adaptations, providing insights into both fundamental mechanisms and evolutionary biology .

What controls should be included when investigating RNF152's role in apoptosis versus its other cellular functions?

When investigating RNF152's role in apoptosis versus its other cellular functions, researchers should include a comprehensive set of controls to distinguish between these distinct activities:

1. Expression Level Controls:

  • Titrate RNF152 expression across multiple levels to distinguish threshold-dependent effects

  • Include both low expression conditions (mimicking physiological levels) and high expression (potentially triggering apoptosis)

  • Use inducible expression systems to enable temporal control

2. Domain-Specific Mutant Controls:

  • Wild-type RNF152: Positive control exhibiting all functions

  • C30S mutant: Disrupts E3 ligase activity while maintaining structure

  • RING domain deletion (RNF152-ΔR): Eliminates E3 ligase function

  • Transmembrane domain deletion (RNF152-ΔTM): Alters subcellular localization

  • These mutants help dissect which domains are essential for apoptosis versus other functions

3. Apoptosis-Specific Controls:

  • Positive controls: Known apoptosis inducers (staurosporine, TNFα)

  • Apoptosis inhibitor controls: Z-VAD-FMK (pan-caspase inhibitor)

  • Non-apoptotic cell death controls: Necrostatin-1 (necroptosis inhibitor)

  • Multiple apoptosis detection methods:

    • Annexin V/PI staining (early/late apoptosis)

    • TUNEL assay (DNA fragmentation)

    • Caspase activation (caspase-3/7 activity)

    • Mitochondrial membrane potential (JC-1 staining)

4. Pathway-Specific Controls:

  • For TLR/IL-1R signaling studies:

    • MyD88 knockout/knockdown cells as negative controls

    • LPS or IL-1β treatment as positive controls

    • Pathway inhibitor controls (e.g., TAK1 inhibitors)

  • For Delta-Notch signaling studies:

    • DAPT (γ-secretase inhibitor) as Notch pathway inhibitor

    • Notch intracellular domain (NICD) overexpression as positive control

5. Cell Type and Context Controls:

  • Test multiple cell types with different sensitivity to apoptosis

  • Include primary cells versus cell lines

  • Test under different conditions:

    • Normal growth conditions

    • Stress conditions (serum starvation, hypoxia)

    • Developmental context (for zebrafish studies)

6. Temporal Controls:

  • Include time-course experiments to distinguish between immediate and delayed effects

  • Use pulse-chase approaches to track the fate of RNF152-expressing cells over time

By systematically employing these controls, researchers can effectively delineate RNF152's pro-apoptotic functions from its roles in developmental signaling and inflammatory pathways, allowing for more precise characterization of this multifunctional protein .

What are the best approaches for investigating potential substrate proteins of RNF152's E3 ligase activity?

Identifying and validating substrate proteins of RNF152's E3 ligase activity requires a multi-faceted approach that combines unbiased discovery methods with targeted validation techniques:

1. Unbiased Substrate Identification Methods:

  • Proximity-based Labeling:

    • BioID or TurboID fusion with RNF152 to identify proximal proteins

    • APEX2-based proximity labeling in lysosomal membranes

    • Compare wild-type versus catalytically inactive (C30S) RNF152 to identify E3-dependent interactions

  • Ubiquitinome Analysis:

    • Global ubiquitinome profiling using di-Gly remnant antibodies

    • Compare cells with RNF152 overexpression, knockdown, and knockout

    • Enrich for K48-linked ubiquitinated proteins, as RNF152 has been shown to form these chains

  • Co-immunoprecipitation Coupled with Mass Spectrometry:

    • Immunoprecipitate RNF152 under conditions that preserve transient enzyme-substrate interactions

    • Use crosslinking approaches to stabilize interactions

    • Compare binding partners of wild-type versus C30S mutant

2. Targeted Validation Techniques:

  • In Vitro Ubiquitination Assays:

    • Reconstitute ubiquitination reactions with purified components

    • Include E1, appropriate E2 enzyme, RNF152, ubiquitin, ATP, and candidate substrate

    • Use western blotting to detect ubiquitin conjugation to substrate

  • Cell-based Validation:

    • Co-expression of RNF152 and candidate substrate

    • Monitor substrate ubiquitination, stability, and localization

    • Use cycloheximide chase experiments to assess substrate half-life

  • Domain Mapping:

    • Determine substrate recognition motifs through deletion/mutation analysis

    • Define minimal regions required for interaction and ubiquitination

3. Substrate Specificity Profiling:

  • E2 Enzyme Preference:

    • Screen multiple E2 enzymes to determine RNF152's preferred partner(s)

    • Identify E2-E3 combinations that enable substrate-specific ubiquitination

  • Ubiquitin Chain Linkage Analysis:

    • Use ubiquitin mutants (K48R, K63R, etc.) to determine chain types

    • Employ linkage-specific antibodies or mass spectrometry

4. Functional Validation:

  • Mapping Ubiquitination Sites:

    • Use mass spectrometry to identify specific lysine residues modified

    • Create lysine-to-arginine mutants of the substrate to validate sites

  • Physiological Significance Assessment:

    • Generate substrate mutants resistant to RNF152-mediated ubiquitination

    • Test whether these mutants rescue phenotypes in relevant biological contexts

    • Correlate substrate ubiquitination with functional outcomes

5. Known Substrate Investigation:

  • RagA GTPase Analysis:

    • RagA has been identified as an RNF152 substrate in the context of amino acid starvation

    • Examine RagA ubiquitination and turnover in zebrafish development

    • Investigate whether RagA regulation contributes to developmental phenotypes

These comprehensive approaches will enable researchers to build a more complete picture of RNF152's substrate network and better understand how its E3 ligase activity contributes to its diverse biological functions .

What are the most promising directions for future research on RNF152 in neurodevelopmental disorders?

Given RNF152's essential role in neurodevelopment, particularly in Delta-Notch signaling and proper formation of brain structures, several promising research directions emerge for investigating its potential involvement in neurodevelopmental disorders:

1. Human Genetic Association Studies:

  • Screen for RNF152 mutations or expression changes in patients with neurodevelopmental disorders, particularly those affecting:

    • Visual system development (retinal disorders, congenital visual impairments)

    • Midbrain-hindbrain boundary defects (cerebellar hypoplasia, pontocerebellar hypoplasia)

    • Rhombomere-derived structures (hindbrain malformations)

  • Correlate genetic variants with phenotypic severity and specific neural defects

  • Create a comprehensive database linking RNF152 variants to clinical presentations

2. Mechanistic Studies of Neurogenesis Regulation:

  • Investigate how RNF152 regulates the balance between neural progenitor maintenance and differentiation

  • Examine interactions with established neurodevelopmental pathways beyond Notch (Wnt, Shh, BMP)

  • Map the temporal requirements of RNF152 during critical windows of neurogenesis using inducible systems

3. Advanced Model Systems Development:

  • Generate conditional knockout models to bypass early embryonic requirements

  • Create human iPSC-derived neural organoids with RNF152 mutations

  • Develop zebrafish models expressing human RNF152 variants identified in patients

  • Implement CRISPR-based screens to identify genetic modifiers of RNF152-associated phenotypes

4. Circuit-level Analysis:

  • Examine how RNF152 deficiency affects the establishment of neural circuits

  • Perform electrophysiological studies to determine functional consequences

  • Use connectomics approaches to map altered neural connectivity patterns

5. Therapeutic Exploration:

  • Test whether temporal modulation of Notch signaling can rescue RNF152-associated developmental defects

  • Investigate cell transplantation approaches using genetically corrected neural progenitors

  • Explore gene therapy approaches to restore RNF152 function in affected neural populations

6. Translational Research:

  • Develop biomarkers for early detection of RNF152-associated neurodevelopmental disorders

  • Establish high-throughput screening platforms to identify compounds that modulate RNF152 function or downstream pathways

  • Create patient-derived models to enable personalized therapeutic approaches

These research directions could significantly advance our understanding of RNF152's role in neurodevelopmental disorders and potentially lead to novel diagnostic and therapeutic strategies for patients with these conditions .

How might researchers investigate the intersection between RNF152's developmental roles and inflammatory functions?

The dual role of RNF152 in both developmental processes and inflammatory signaling presents a unique opportunity to investigate the intersection between these biological contexts. Future research should consider the following approaches:

1. Developmental Programming of Immune Responses:

  • Examine whether developmental RNF152 expression patterns influence later-life inflammatory responses

  • Implement stage-specific conditional knockout models to dissect temporal requirements

  • Compare inflammatory responses in tissues with different developmental RNF152 expression histories

  • Design experiments to test whether early developmental perturbations in RNF152 alter adult immune function

2. Shared Molecular Mechanisms Analysis:

  • Investigate whether RNF152's ability to promote MyD88 oligomerization in immune signaling has parallels in developmental contexts:

    • Test if RNF152 similarly promotes oligomerization of Notch pathway components

    • Examine common structural requirements for these functions

    • Compare protein interaction networks between contexts

3. Context-specific Regulation of RNF152:

  • Analyze tissue-specific and developmental-stage-specific post-translational modifications of RNF152

  • Identify context-specific binding partners that may direct RNF152 toward developmental versus inflammatory functions

  • Examine subcellular localization differences across contexts

4. Transgenic Reporter Systems:

  • Develop dual reporter systems to simultaneously monitor Notch and NF-κB pathway activation

  • Create RNF152 biosensors to track its activity and localization in real-time during development and inflammation

  • Implement these systems in zebrafish to visualize pathway dynamics in vivo

5. Cross-talk Between Developmental and Inflammatory Pathways:

  • Investigate whether inflammatory stimuli alter developmental outcomes through RNF152-dependent mechanisms

  • Examine if developmental signals modulate inflammatory responses via RNF152

  • Test whether known developmental regulators of RNF152 also affect its inflammatory functions

6. Systems Biology Approaches:

  • Perform integrated multi-omics analysis across developmental timepoints and inflammatory conditions

  • Create computational models of RNF152 regulation and function across contexts

  • Identify network hubs where developmental and inflammatory pathways intersect via RNF152

7. Disease Model Applications:

  • Investigate neurodevelopmental disorders with inflammatory components

  • Examine whether developmental RNF152 dysfunction contributes to inflammatory disorders later in life

  • Test whether modulating RNF152 during development affects susceptibility to inflammatory diseases

This comprehensive research approach would provide valuable insights into how a single molecule can serve distinct functions in different biological contexts and potentially reveal fundamental principles of developmental programming of immune responses .

What emerging technologies could advance our understanding of RNF152's functions across multiple biological systems?

Several cutting-edge technologies hold promise for advancing RNF152 research across developmental, inflammatory, and other biological contexts:

1. Advanced Imaging Technologies:

  • Super-resolution microscopy (STORM, PALM, STED) to visualize RNF152's precise subcellular localization and co-localization with binding partners at nanometer resolution

  • Lattice light-sheet microscopy for long-term live imaging of RNF152 dynamics during development with minimal phototoxicity

  • Correlative light and electron microscopy (CLEM) to visualize RNF152 in relation to ultrastructural features, particularly at lysosomal membranes

  • Expansion microscopy combined with multiplexed protein detection to map RNF152's association with signaling complexes

2. Genetic Engineering Approaches:

  • Base editing and prime editing for precise introduction of patient-specific RNF152 variants

  • Conditional degron systems for acute, temporally controlled depletion of RNF152 protein

  • Synthetic genomics to create minimal systems for studying RNF152 functions

  • CRISPR activation/interference (CRISPRa/CRISPRi) for tunable modulation of RNF152 expression

3. Protein Interaction and Structural Biology Tools:

  • Cryo-electron microscopy to determine structures of RNF152 in complex with binding partners

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic protein interactions

  • Crosslinking mass spectrometry (XL-MS) to capture transient interactions between RNF152 and substrates

  • AlphaFold and RoseTTAFold integration for predictive modeling of RNF152 complexes

4. Single-cell Technologies:

  • Single-cell RNA-seq with spatial resolution to map RNF152 expression patterns in developing tissues with cellular precision

  • Single-cell proteomics to analyze RNF152 protein levels and modifications across cell populations

  • CyTOF and spectral flow cytometry for high-dimensional analysis of RNF152 in relation to cellular phenotypes

  • Patch-seq to correlate RNF152 expression with electrophysiological properties in neurons

5. Advanced in vitro Systems:

  • Organ-on-chip technologies to model RNF152 function in physiologically relevant microenvironments

  • Human brain organoids to study RNF152 in human neurodevelopment

  • Bioprinting of tissue models with defined RNF152 expression patterns

  • Microfluidic systems for real-time monitoring of signaling dynamics

6. Systems Biology and Computational Approaches:

  • Multi-omics integration combining transcriptomics, proteomics, and ubiquitinomics data

  • Network analysis algorithms to position RNF152 within cellular signaling networks

  • Machine learning approaches to predict context-specific functions and interactions

  • Virtual screening for small molecule modulators of RNF152 activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.