Recombinant Danio rerio E3 ubiquitin-protein ligase RNF19B (rnf19b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
rnf19b; si:rp71-45k5.9; E3 ubiquitin-protein ligase RNF19B; RING finger protein 19B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-701
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
rnf19b
Target Protein Sequence
MGSEKDSESPHSSVSGIPNPKCRGPGKKQGRISFHSLFHSKRGPRGSKANVGTPLAQQLH QQQQIQQQQLLQPPTPTNVSSDPSTADPAEPLSTSQASLGGQELLECPLCLVRQPAEQLP ELQGCSHRSCLCCLRQYLRIEITESRVQLSCPECAERLAPWQVALILDDPNLMEKYEEFL LRRCLASDPDCRWCPAPDCGFAVIASGCASCPRLVCRREGCGAEFCYHCKQAWHPNQTCD SARQQRALSLRTHSNHSPSYTAEQGHTDDIKPCPRCGAYIIKMNDGSCNHMTCAVCGCEF CWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGITLIAGIAVPAMVI GIPVYIGRKIHSHYEGKKTSHHRRNLAITGGVALSIITAPVIAAVSVGIGVPIMLAYVYG VVPISLCRGGGCGVSRGKGRGVRIDFDEDDGPITVADAWRALKSPSLGESSLEGAASGLS TTSPSEGLSVAPGGLGDTPHFNTLAGGALGARTGKYSRLEVQGTELGKEVAGRETGSLGA ASDCASTRGMAGSITSSYTLPDREGTNLEIQVDIETKPSHLCLTTEEDLAPPTAAMAPGV GEEPQDCSSRRSRTVMDSPLGLSPGMSLREGLRDVTLAQPESIRSDLEMSDTQSDDIAEL TSDDCDSPHPKSCHGAPPQATCRALNPTDSLHCPDNVILYV
Uniprot No.

Target Background

Function

RNF19B is an E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 via a thioester intermediate. It then directly transfers ubiquitin to target substrates, including UCKL1. RNF19B is involved in the cytotoxic activity of natural killer cells and cytotoxic T lymphocytes. It also exhibits a protective effect against staurosporin-induced cell death.

Database Links
Protein Families
RBR family, RNF19 subfamily
Subcellular Location
Cytoplasmic granule membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of RNF19B in Danio rerio?

RNF19B functions as an E3 ubiquitin ligase that mediates the ubiquitination of multiple substrates, playing crucial roles in protein degradation and cellular signaling pathways. As a member of the E3 ubiquitin ligase family, zebrafish RNF19B likely participates in ubiquitin-dependent trafficking of membrane proteins, similar to other E3 ligases like Mindbomb1. In mammals, RNF19B has been shown to be essential for immune cell function, particularly in NK cells and macrophages, facilitating cytotoxic functions and the release of signaling molecules . While zebrafish-specific functions are still being characterized, comparative analyses suggest conserved roles in signaling pathway regulation and protein turnover across vertebrates.

What experimental approaches are commonly used to express and purify recombinant Danio rerio RNF19B?

For successful expression and purification of recombinant zebrafish RNF19B:

  • Expression Systems:

    • Bacterial expression (E. coli BL21(DE3)) for the RING finger domain only

    • Insect cell expression (Sf9 or Hi5 cells) for full-length protein with proper folding

    • Mammalian expression systems (HEK293T cells) for post-translational modifications

  • Purification Strategy:

    • Affinity chromatography using His-tag or GST-tag fusion proteins

    • Ion exchange chromatography as a secondary purification step

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality Control:

    • SDS-PAGE to confirm size and purity

    • Western blotting for identity confirmation

    • In vitro ubiquitination assays to verify enzymatic activity

How can the enzymatic activity of recombinant Danio rerio RNF19B be assessed in vitro?

The enzymatic activity of recombinant zebrafish RNF19B can be evaluated through in vitro ubiquitination assays that measure its ability to transfer ubiquitin to substrate proteins:

  • Components Required:

    • Purified recombinant RNF19B

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme (multiple E2s should be tested for specificity)

    • Ubiquitin (unmodified or tagged for detection)

    • ATP regeneration system

    • Potential substrate proteins

    • Reaction buffer with appropriate pH and salt concentration

  • Detection Methods:

    • Western blotting using anti-ubiquitin antibodies

    • Mass spectrometry to identify ubiquitination sites

    • Fluorescence-based assays using labeled ubiquitin

  • Controls:

    • Negative control without ATP

    • Catalytically inactive RNF19B mutant (RING domain mutation)

    • Positive control with a known E3 ligase/substrate pair

How does RNF19B function differ between Danio rerio and mammalian models?

Comparing zebrafish RNF19B with its mammalian counterparts reveals both conserved and divergent features:

  • Structural Conservation:

    • The RING finger domain shows high sequence homology (>70%) between zebrafish and mammals

    • The substrate recognition domains may show greater divergence, potentially leading to species-specific substrate preferences

  • Functional Conservation:

    • In mammals, RNF19B has been implicated in immune regulation and tumor progression

    • Studies have shown RNF19B can facilitate the polarization of macrophages into the M2 phenotype, creating an immunosuppressive microenvironment that contributes to cancer progression

    • Zebrafish RNF19B may share immune regulatory functions but might also possess lineage-specific roles in development

  • Expression Pattern Differences:

    • Developmental timing and tissue-specific expression patterns may vary between species

    • These differences could be evaluated through comparative transcriptomics and in situ hybridization studies

What are the validated substrates of Danio rerio RNF19B, and how can new substrates be identified?

While comprehensive substrate characterization for zebrafish RNF19B is ongoing, several approaches can be employed to identify and validate potential substrates:

  • Prediction-Based Approaches:

    • Bioinformatic prediction of ubiquitination sites in candidate proteins

    • Structural modeling of protein-protein interactions

    • Comparative analysis with known mammalian RNF19B substrates

  • Experimental Identification:

    • Immunoprecipitation coupled with mass spectrometry (IP-MS)

    • Proximity-based labeling methods (BioID or APEX)

    • Global proteomics comparing wild-type and RNF19B knockout/knockdown zebrafish

    • Ubiquitin remnant profiling to identify ubiquitinated proteins

  • Validation Methods:

    • In vitro ubiquitination assays with purified candidate substrates

    • Co-immunoprecipitation to confirm direct interaction

    • In vivo ubiquitination assays in zebrafish cells

    • Analysis of substrate stability and levels in RNF19B-depleted systems

What role might RNF19B play in zebrafish immune development and function?

Based on mammalian studies, RNF19B likely plays important roles in zebrafish immune development and function:

  • Potential Immune Functions:

    • Regulation of macrophage polarization (as observed in human studies where RNF19B facilitates M2 macrophage polarization)

    • Modulation of inflammatory responses

    • Potential involvement in hematopoietic stem cell development

  • Experimental Approaches:

    • CRISPR/Cas9-mediated knockout or knockdown of RNF19B in zebrafish

    • Transgenic zebrafish with fluorescently labeled immune cell populations

    • Analysis of immune cell development and function in RNF19B-deficient zebrafish

    • Infection models to assess immune response efficacy

  • Relevant Observations from Mammalian Studies:

    • RNF19B expression is essential for both NK cells and macrophages to facilitate cytotoxic function

    • RNF19B has shown substantial involvement in immune responses against tumors, particularly within lymphoma and breast cancer

    • In HCC studies, RNF19B positively correlated with immune checkpoint-related genes, particularly PD-1 and CTLA4

What are the key considerations for designing CRISPR/Cas9 knockout models of RNF19B in zebrafish?

Developing effective CRISPR/Cas9 knockout models for zebrafish RNF19B requires careful planning:

  • gRNA Design Considerations:

    • Target early exons to ensure complete loss of function

    • Avoid regions with high sequence similarity to other E3 ligases

    • Design multiple gRNAs to increase knockout efficiency

    • Check for potential off-target effects using zebrafish genome databases

  • Knockout Verification Methods:

    • T7 endonuclease assay to detect mutations

    • Direct sequencing of target region

    • Western blotting to confirm protein loss

    • qRT-PCR to assess transcript levels and potential compensation by related genes

  • Potential Challenges:

    • Developmental lethality (may require conditional knockout strategies)

    • Genetic compensation by related E3 ligases

    • Mosaic mutations in F0 fish (requiring careful breeding strategies)

How can protein interaction networks of Danio rerio RNF19B be comprehensively mapped?

Mapping the interactome of zebrafish RNF19B provides crucial insights into its biological functions:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use RNF19B or specific domains as bait to screen zebrafish cDNA libraries

    • Validate positive interactions with secondary assays

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged RNF19B in zebrafish cells or tissues

    • Immunoprecipitate RNF19B and associated proteins

    • Identify interacting partners by mass spectrometry

    • Distinguish specific interactors from background using appropriate controls

  • Proximity-Based Labeling:

    • Generate RNF19B fusions with BioID or APEX2

    • Express in zebrafish cells to label proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Network Analysis and Visualization:

    • Integrate multiple datasets using computational approaches

    • Visualize networks using tools like Cytoscape

    • Perform Gene Ontology enrichment analysis to identify biological processes

What are the most effective approaches for studying RNF19B subcellular localization and trafficking in zebrafish cells?

Understanding the subcellular distribution and dynamics of RNF19B provides insights into its function:

  • Imaging Approaches:

    • Fluorescent protein fusions (ensuring tags don't interfere with function)

    • Immunofluorescence with specific antibodies

    • Super-resolution microscopy for detailed localization

    • Live-cell imaging to track dynamic changes in localization

  • Subcellular Fractionation:

    • Isolation of different cellular compartments (membrane, cytosol, nucleus)

    • Western blotting of fractions to detect RNF19B

    • Mass spectrometry-based proteomics of fractions

  • Co-localization Studies:

    • Simultaneous visualization with markers for cellular compartments

    • Quantitative co-localization analysis

    • Proximity ligation assay (PLA) for protein-protein interactions in situ

How can zebrafish RNF19B be utilized to study potential roles in cancer progression and immune evasion?

Zebrafish models offer unique advantages for studying RNF19B in cancer contexts:

  • Zebrafish Cancer Models:

    • Xenotransplantation of human cancer cells into RNF19B mutant zebrafish

    • Genetic zebrafish cancer models with RNF19B manipulation

    • Chemical-induced cancer models with altered RNF19B expression

  • Immune-Cancer Interaction Studies:

    • Transparent zebrafish larvae allow real-time visualization of immune-tumor cell interactions

    • Multi-color imaging to track immune cells, tumor cells, and manipulated RNF19B

    • Analysis of macrophage polarization in the presence or absence of RNF19B

  • Relevance from Human Studies:

    • Human studies have shown that RNF19B may facilitate the polarization of macrophages into the M2 phenotype, fostering an immunosuppressive microenvironment

    • RNF19B expression was positively correlated with immune checkpoint genes (PD-1 and CTLA4), suggesting potential roles in immune evasion mechanisms

What signaling pathways are regulated by RNF19B in zebrafish, and how can these be experimentally validated?

Investigating RNF19B-regulated signaling pathways:

  • Candidate Pathways:

    • Wnt signaling (based on studies of other E3 ligases like Mindbomb1)

    • Notch signaling (common pathway regulated by E3 ubiquitin ligases)

    • NF-κB and inflammatory signaling pathways

    • Immune checkpoint pathways (based on correlations with PD-1 and CTLA4)

  • Pathway Analysis Methods:

    • Transcriptomic analysis of RNF19B knockout/knockdown zebrafish

    • Phosphoproteomic profiling to identify altered signaling

    • Reporter assays for specific pathway activation

    • Small molecule inhibitors to validate pathway connections

  • Validation Approaches:

    • Genetic rescue experiments

    • Epistasis analysis with known pathway components

    • Direct biochemical assessment of pathway component ubiquitination

    • In vivo imaging of pathway activity using transgenic reporter lines

How does RNF19B expression correlate with specific clinicopathological features in disease models?

Based on human HCC studies, several correlations might be explored in zebrafish disease models:

  • Expression Pattern Analysis:

    • Examine RNF19B expression across different disease stages

    • Compare expression in normal versus pathological tissues

    • Analyze correlation with disease progression markers

  • Clinicopathological Correlations:

    • In human HCC, RNF19B expression correlates with:

      • Liver cirrhosis (χ² = 5.050, P = 0.024)

      • Vascular invasion (χ² = 18.792, P < 0.001)

      • Portal vein invasion (χ² = 15.381, P < 0.001)

      • Tumor size (χ² = 38.48, P < 0.001)

      • TNM stage (χ² = 38.517, P < 0.001)

    • Similar correlations could be explored in zebrafish disease models

  • Mechanistic Studies:

    • Investigate how RNF19B contributes to each pathological feature

    • Identify substrate proteins relevant to each phenotype

    • Develop targeted interventions based on mechanistic insights

What are the optimal conditions for preserving RNF19B enzymatic activity during recombinant protein preparation?

E3 ubiquitin ligases like RNF19B can be challenging to maintain in an active state:

  • Buffer Optimization:

    • Test pH range (typically 7.0-8.0)

    • Optimize salt concentration (usually 150-300 mM NaCl)

    • Include reducing agents (DTT or TCEP) to maintain RING domain structure

    • Add zinc ions (10-50 μM ZnCl₂) to stabilize the RING finger domain

    • Consider including glycerol (10-15%) for stability

  • Storage Considerations:

    • Flash freeze in liquid nitrogen and store at -80°C

    • Test stability with multiple freeze-thaw cycles

    • Consider adding stabilizing agents like trehalose

    • Aliquot to avoid repeated freeze-thaw cycles

  • Activity Preservation:

    • Determine half-life at different temperatures

    • Test activity preservation with different additives

    • Consider immobilization strategies for prolonged stability

    • Optimize protein concentration to prevent aggregation

What are the main technical challenges in studying RNF19B post-translational modifications and how can they be overcome?

E3 ligases like RNF19B can themselves undergo various post-translational modifications:

  • Identification Challenges:

    • Low abundance of modified forms

    • Potential rapid turnover of modifications

    • Technical limitations in detecting certain modifications

  • Advanced Detection Methods:

    • Phospho-specific antibodies for common phosphorylation sites

    • Mass spectrometry with enrichment strategies for specific modifications

    • Specific inhibitors of modification-removing enzymes to stabilize modifications

    • Targeted mass spectrometry approaches (MRM/PRM) for sensitive detection

  • Functional Analysis:

    • Site-directed mutagenesis of modification sites

    • Expression of modification-mimicking mutants

    • In vitro reconstitution with and without specific modifications

    • Temporal analysis of modification patterns during cellular processes

Post-Translational ModificationDetection MethodFunctional Analysis Approach
PhosphorylationPhospho-specific antibodies, TiO₂ enrichment + MSPhospho-mimetic mutations (S/T to D/E)
Auto-ubiquitinationUbiquitin-remnant antibodies, His-tagged Ub pulldownK to R mutations at ubiquitination sites
SUMOylationSUMO-specific antibodies, SUMO-remnant MSK to R mutations at SUMOylation sites
S-nitrosylationBiotin-switch technique, SNO-RACC to S mutations

How can computational approaches aid in predicting RNF19B substrate specificity?

Computational methods can complement experimental approaches in substrate prediction:

  • Sequence-Based Prediction:

    • Machine learning algorithms trained on known E3-substrate pairs

    • Recognition motif identification through multiple sequence alignment

    • Conservation analysis across species to identify functionally important regions

    • Disorder prediction to identify potential ubiquitination sites

  • Structure-Based Modeling:

    • Homology modeling of RNF19B structure

    • Protein-protein docking with potential substrates

    • Molecular dynamics simulations to validate interactions

    • Binding energy calculations to rank potential substrates

  • Network-Based Approaches:

    • Integrating protein-protein interaction data

    • Co-expression analysis to identify potential substrates

    • Pathway enrichment to identify biological processes

    • Cross-species conservation of interaction networks

How might RNF19B function in zebrafish development and tissue regeneration?

Zebrafish are excellent models for studying development and regeneration:

  • Developmental Roles:

    • Temporal and spatial expression analysis during embryogenesis

    • Loss-of-function studies at different developmental stages

    • Identification of developmental signaling pathways affected by RNF19B

    • Cell lineage-specific knockout to identify tissue-specific requirements

  • Regeneration Models:

    • Fin amputation regeneration assays

    • Heart injury models

    • Liver regeneration studies

    • Central nervous system regeneration models

  • Mechanistic Investigations:

    • Identification of RNF19B substrates involved in regeneration

    • Analysis of inflammatory responses during regeneration

    • Investigation of cell proliferation and differentiation pathways

    • Comparison with mammalian wound healing/regeneration mechanisms

What approaches can be used to develop specific inhibitors or modulators of zebrafish RNF19B activity?

Developing tools to modulate RNF19B function:

  • Small Molecule Development:

    • Structure-based virtual screening targeting the RING domain

    • High-throughput screening of chemical libraries

    • Fragment-based drug discovery approaches

    • Allosteric inhibitor development targeting non-catalytic domains

  • Peptide-Based Inhibitors:

    • Design of substrate-competitive peptides

    • Stapled peptides to improve stability and cell penetration

    • Phage display to identify high-affinity binding peptides

    • Peptide aptamer development

  • Testing and Validation:

    • In vitro ubiquitination assays

    • Cell-based assays in zebrafish cell lines

    • In vivo testing in zebrafish embryos

    • Selectivity profiling against other E3 ligases

How can single-cell approaches advance our understanding of RNF19B function in zebrafish models?

Single-cell technologies offer unprecedented resolution for functional studies:

  • Single-Cell Transcriptomics:

    • Identify cell types expressing RNF19B

    • Analyze transcriptional effects of RNF19B knockout at single-cell resolution

    • Map RNF19B-dependent gene regulatory networks

    • Identify rare cell populations affected by RNF19B function

  • Spatial Transcriptomics:

    • Map spatial distribution of RNF19B expression

    • Correlate with expression of potential substrates

    • Analyze spatial relationships between RNF19B-expressing cells and specific microenvironments

  • Single-Cell Proteomics:

    • Detect cell-specific changes in protein abundance upon RNF19B manipulation

    • Map post-translational modification landscapes

    • Identify cell type-specific RNF19B substrates

  • Integration and Analysis:

    • Multi-modal data integration

    • Trajectory analysis to map developmental processes

    • Network analysis to identify key regulatory hubs

    • Comparative analysis with mammalian single-cell datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.