Recombinant Danio rerio E3 ubiquitin-protein ligase synoviolin (syvn1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio E3 Ubiquitin-Protein Ligase Synoviolin (syvn1)

Recombinant Danio rerio E3 ubiquitin-protein ligase synoviolin (syvn1), also known as synovial apoptosis inhibitor 1 or synoviolin, is a zebrafish homolog of the mammalian SYVN1 protein. This enzyme belongs to the RING-type E3 ubiquitin ligase family and plays a conserved role in endoplasmic reticulum-associated degradation (ERAD), a quality control pathway that tags misfolded proteins for proteasomal degradation .

Key Gene and Protein Information

AttributeDetails
Gene Namesyvn1, hrd1 (Danio rerio homologs of human SYVN1)
Uniprot IDQ803I8
SynonymsSynovial apoptosis inhibitor 1, E3 ubiquitin-protein ligase synoviolin
FunctionUbiquitination of misfolded proteins, ER stress response, mitochondrial regulation

Production and Biochemical Characteristics

Recombinant Danio rerio syvn1 is produced in E. coli or mammalian cell systems, with partial protein sequences used for functional studies.

Applications

  • ELISA: Used in immunoassays to detect syvn1-specific antibodies .

  • Western Blot: Validates protein expression and interaction studies .

  • Functional Assays: Studies ubiquitination activity and substrate interactions .

Interaction Networks

Syvn1 interacts with heat shock proteins (e.g., HSP90) and components of the ubiquitin-proteasome system . In zebrafish, this may modulate stress responses or development.

Role in ER-Associated Degradation (ERAD)

Syvn1 is critical for ERAD, a pathway that retrotranslocates misfolded proteins to the cytosol for proteasomal degradation . Defects in SYVN1 homologs are linked to diseases like arthritis and obesity in mammals .

Research Applications in Zebrafish Models

Recombinant syvn1 is used to study zebrafish models of disease, leveraging the conserved ERAD machinery.

Key Applications

ApplicationDescription
ER Stress StudiesInvestigating syvn1’s role in clearing misfolded proteins during stress
Metabolic ResearchExploring syvn1’s interaction with mitochondrial regulators (e.g., PGC-1β)
ImmunoassaysValidating antibody specificity using ELISA or Western blot

Comparison of Recombinant syvn1 Products

Product CodeHostSourcePurityApplications
CSB-EP801904DIL1E. coliPartial protein>85%Western blot, ELISA
CSB-MP801904DIL1Mammalian cellPartial protein>85%Western blot, ELISA
CSB-CF801904DILCell-freePartial proteinN/AELISA

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
syvn1; hrd1; zgc:55735; zgc:77108; E3 ubiquitin-protein ligase synoviolin; RING-type E3 ubiquitin transferase synoviolin; Synovial apoptosis inhibitor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-625
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
HAYFLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKLMRKVFFGQLRAAEMEHLIER SWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWVFHFR VLSLMVLLGVMDFLFVNHACHSIITRGASVQLVFGFEYAILMTMVLTTFIKYTLHTIDLQ SENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVT DAIMSRRAIRNMNTLYPDATPEDLQATDNVCIICREEMVTGAKKLPCNHIFHSSCLRSWF QRQQTCPTCRMDVLRASQPNQTPAPPAAQAPAPPAPANAPIPPPVNVAPGMIPQFPPGLF PFWGPFPGAPPPAVPGAPAAPTDTPQPSSDGAQGAESGAGGLAQSTAEAASAAPGAMPGF PFTMPPPFPSAPWLPMPPPPPFMSSMPPPPSSLSSMSEAELRELEQEGRRGLEARLQCLH NIHTLLDAAMLNIHHYLSTVATLSPPRSETNTGETSESANVESSPSTANTETAGQEIQSQ SGESINGAAGFSQPDSTTEGEKDVKEEDEDDGEPSAAELRRRRLRKLETTNTPDHGNLLK LASVN
Uniprot No.

Target Background

Function

Danio rerio E3 ubiquitin-protein ligase synoviolin (syvn1) is an E3 ubiquitin-protein ligase that specifically accepts ubiquitin from the endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, thereby targeting them for degradation. It is a critical component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD), mediating the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Furthermore, it promotes the degradation of naturally short-lived proteins. Synoviolin protects cells from ER stress-induced apoptosis by sequestering p53 in the cytoplasm and facilitating its degradation, thus negatively regulating p53's transcriptional, cell cycle regulatory, and apoptotic functions.

Database Links
Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Danio rerio E3 ubiquitin-protein ligase synoviolin and what are its key structural features?

Recombinant Danio rerio E3 ubiquitin-protein ligase synoviolin (syvn1) is a laboratory-produced version of zebrafish synoviolin protein, an important E3 ubiquitin ligase involved in the ubiquitin-proteasome system. Also known as Synovial apoptosis inhibitor 1, this protein belongs to the RING-finger family of E3 ligases, which are characterized by a conserved catalytic domain responsible for transferring ubiquitin molecules to target substrates . The protein contains multiple transmembrane domains that anchor it to the endoplasmic reticulum (ER) membrane, with the catalytic RING domain facing the cytosolic side. This orientation enables it to recognize and ubiquitinate misfolded proteins as part of the ER-associated degradation (ERAD) pathway.

When produced recombinantly, syvn1 may be generated as a partial sequence focusing on the active domains, which optimizes its utility for research applications . The recombinant form maintains the catalytic functionality of the native protein while providing researchers with controlled experimental conditions and increased availability for diverse studies.

What are the optimal storage conditions for maintaining syvn1 stability?

The stability of recombinant Danio rerio syvn1 is highly dependent on proper storage conditions. According to product information, liquid formulations typically maintain stability for approximately 6 months when stored at -20°C to -80°C, while lyophilized (freeze-dried) formulations can remain stable for up to 12 months at these same temperatures .

For optimal storage and handling:

  • Store stock preparations at -20°C to -80°C for long-term storage

  • Keep working aliquots at 4°C for no longer than one week

  • Avoid repeated freeze-thaw cycles as these significantly compromise protein activity

  • When reconstituting lyophilized protein, briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) to prevent freeze-thaw damage

  • Prepare small working aliquots to minimize the need for repeated thawing

Following these guidelines ensures maximum retention of enzymatic activity and structural integrity for experimental applications.

What are the most effective approaches for reconstituting syvn1 for experimental use?

Proper reconstitution of recombinant Danio rerio syvn1 is critical for preserving its functional activity. The recommended protocol includes several important steps designed to maintain protein integrity:

  • Initial preparation:

    • Centrifuge the vial briefly before opening to collect all material at the bottom

    • For lyophilized protein, carefully remove the stopper to prevent loss of material

  • Reconstitution process:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Mix gently by rotating or inverting the vial rather than vortexing, which can denature the protein

    • Allow complete dissolution at room temperature or 4°C (5-10 minutes)

  • Stabilization:

    • Add glycerol to a final concentration of 5-50% (with 50% being commonly recommended)

    • This provides cryoprotection and maintains enzyme activity during storage

  • Quality control:

    • Verify protein concentration using absorbance at 280 nm or Bradford/BCA assay

    • If necessary, assess enzymatic activity using an in vitro ubiquitination assay

After reconstitution, the preparation should be divided into small working aliquots to avoid repeated freeze-thaw cycles and stored according to the stability guidelines discussed in question 1.2. Proper reconstitution is fundamental to ensuring reliable and reproducible experimental outcomes.

What are the primary experimental applications for recombinant syvn1?

Recombinant Danio rerio syvn1 serves diverse research applications across multiple fields. The primary experimental uses include:

  • Ubiquitination studies:

    • In vitro ubiquitination assays to assess E3 ligase activity

    • Identification and characterization of substrate proteins

    • Investigation of ubiquitin chain linkage preferences

  • Protein-protein interaction analysis:

    • Pull-down assays to identify binding partners

    • Co-immunoprecipitation to verify physiological interactions

    • Surface plasmon resonance or biolayer interferometry for binding kinetics

  • Structural and functional studies:

    • Crystallography or cryo-EM to determine three-dimensional structure

    • Mutational analysis to map functional domains

    • Investigation of regulatory mechanisms affecting enzyme activity

  • Therapeutic target validation:

    • Testing compounds like LS-102 that modulate syvn1 activity

    • Screening for novel inhibitors or activators

    • Assessment of metabolic effects through PGC-1β regulation

  • Inflammasome and pyroptosis research:

    • Investigation of GSDMD ubiquitination and activation

    • Analysis of inflammatory cell death pathways

    • Study of regulatory mechanisms in inflammasome function

  • Antibody production:

    • Immunization for generating specific antibodies

    • Development of detection reagents for diagnostic applications

These applications collectively contribute to our understanding of syvn1's roles in cellular processes including ER-associated degradation, mitochondrial biogenesis, and inflammatory responses, with implications for diseases ranging from metabolic disorders to inflammatory conditions.

What detection methods are most reliable for identifying syvn1 in experimental settings?

Multiple detection methods can be employed to identify and quantify recombinant Danio rerio syvn1 in experimental settings, each offering distinct advantages:

  • Immunological methods:

    • Western blotting: Allows detection of full-length protein and potential degradation products using anti-syvn1 or anti-tag antibodies

    • Enzyme-linked immunosorbent assay (ELISA): Provides quantitative measurement in complex samples

    • Immunofluorescence: Visualizes subcellular localization in fixed cells

  • Enzymatic activity assays:

    • In vitro ubiquitination assays: Monitor the transfer of ubiquitin to substrate proteins

    • FRET-based approaches: Real-time monitoring of enzyme-substrate interactions

    • TUBE (Tandem Ubiquitin Binding Entities) pull-downs: Capture and enrich for active ubiquitination products

  • Mass spectrometry approaches:

    • LC-MS/MS: Peptide identification and post-translational modification analysis

    • MALDI-TOF: Molecular weight confirmation

    • Targeted MS: Absolute quantification using internal standards

  • Tag-based detection:

    • Affinity tag detection (His, FLAG, GST) using commercial antibodies

    • Fluorescent protein fusions for live imaging

    • Enzyme-coupled tags (HaloTag, SNAP-tag) for specific labeling

Detection MethodSensitivitySpecificityInformation ProvidedBest Application
Western BlotMedium-HighHighMolecular weight, integrityProtein expression verification
ELISAHighHighQuantitative concentrationHigh-throughput screening
Activity AssayMediumVery HighFunctional statusInhibitor screening
Mass SpectrometryVery HighVery HighPeptide sequences, modificationsDetailed molecular characterization
Fluorescence MicroscopyMediumMedium-HighSubcellular localizationInteraction studies in cells

The optimal detection method should be selected based on the specific research question, required sensitivity, and available instrumentation. Often, a combination of methods provides the most comprehensive characterization.

How can researchers establish in vitro ubiquitination assays using recombinant syvn1?

Establishing robust in vitro ubiquitination assays using recombinant Danio rerio syvn1 requires careful optimization of multiple components and conditions. Here is a methodological approach:

  • Reaction components preparation:

    • Purified recombinant syvn1 (0.1-1 μM final concentration)

    • E1 ubiquitin-activating enzyme (0.1-0.2 μM)

    • Appropriate E2 ubiquitin-conjugating enzyme (0.5-2 μM)

    • Ubiquitin (10-50 μM, consider using tagged or methylated ubiquitin for specific detection)

    • Candidate substrate protein (0.5-5 μM)

    • ATP regeneration system (2-5 mM ATP, 10 mM creatine phosphate, 0.6 U/mL creatine kinase)

  • Buffer optimization:

    • 50 mM Tris-HCl (pH 7.5-8.0)

    • 5 mM MgCl₂ (required for ATP hydrolysis)

    • 1-2 mM DTT (maintains enzyme activity)

    • 150 mM NaCl (physiological ionic strength)

    • 0.1% NP-40 or Triton X-100 (mimics membrane environment)

  • Reaction assembly:

    • Combine all components except ATP on ice

    • Prepare parallel control reactions (minus E1, minus E2, minus syvn1)

    • Initiate reaction by adding ATP and transfer to 30-37°C

  • Time course sampling:

    • Remove aliquots at defined time points (0, 15, 30, 60, 90 minutes)

    • Immediately quench with SDS-PAGE loading buffer containing β-mercaptoethanol

  • Detection methods:

    • SDS-PAGE followed by Western blotting with anti-ubiquitin antibodies

    • Alternatively, use anti-substrate antibodies to detect mobility shifts

    • For quantitative analysis, include ubiquitination standards

  • Data analysis and validation:

    • Quantify ubiquitinated species using densitometry

    • Determine reaction kinetics by measuring substrate modification over time

    • Validate specificity using known inhibitors or catalytically inactive syvn1 mutants

This methodology can be adapted to investigate specific aspects of syvn1 function, including substrate specificity, chain linkage preferences, and the effects of potential modulators like LS-102 . The assay conditions may require further optimization depending on the specific substrate being tested, such as PGC-1β in metabolic studies or GSDMD in inflammasome research .

What advantages does the zebrafish model offer for studying syvn1 function?

Danio rerio (zebrafish) provides exceptional advantages as a model organism for studying syvn1 function, combining vertebrate relevance with experimental tractability:

  • Genetic and developmental advantages:

    • Transparent embryos allowing direct visualization of developmental processes

    • Rapid development (fertilized eggs develop major organs within 36 hours)

    • High fecundity (200-300 eggs per mating) enabling large-scale experiments

    • External fertilization and development facilitating manipulation

    • Fully sequenced genome with conservation of most human disease genes

  • Experimental accessibility:

    • Well-established genetic manipulation techniques (CRISPR-Cas9, transgenesis)

    • Amenable to high-throughput chemical screening

    • Histopathological analysis of tissues such as gills provides insights into structural changes

    • Ability to perform whole-organism imaging of protein dynamics

  • Biological relevance:

    • Zebrafish syvn1 shares significant homology with human synoviolin

    • Conservation of major signaling pathways and physiological processes

    • Vertebrate model system with more translational relevance than invertebrates

    • Complex organ systems allowing study of tissue-specific effects

  • Application-specific benefits:

    • Excellent model for environmental toxicology studies, as shown in nanoparticle exposure experiments

    • Useful for studying developmental roles of syvn1 in organogenesis

    • Enables investigation of systemic effects of altered syvn1 function

  • Cost and practical considerations:

    • Lower maintenance costs compared to mammalian models

    • Requires less space and specialized equipment

    • Reduced ethical concerns compared to mammalian models

    • High-throughput capacity for screening genetic or chemical modifiers

These advantages position zebrafish as an ideal model system for investigating syvn1 function across multiple levels, from molecular mechanisms to whole-organism physiology, bridging the gap between in vitro studies and more complex mammalian models.

How do histopathological approaches in zebrafish enhance understanding of syvn1 function?

Histopathological approaches in zebrafish provide valuable insights into the structural and functional consequences of altered syvn1 activity, particularly in the context of stress responses and environmental challenges:

  • Gill histopathology as a model system:

    • Zebrafish gill tissue serves as an excellent indicator of cellular stress and adaptive responses

    • Exposure to environmental stressors like Cr and Ba doped TiO₂ nanoparticles produces observable histopathological changes

    • These alterations include aneurism, dilated and clubbed tips, hyperplasia, oedema, curvature, fusion of lamellae, increased mucous secretion, and proliferation in the erythrocytes of cartilaginous core

  • Methodological approaches:

    • Standard histological preparation using formalin fixation and paraffin embedding

    • Hematoxylin and eosin (H&E) staining for general morphological assessment

    • Specialized staining techniques for specific cellular components

    • Morphometric analysis using software like Axio Vision to quantify structural changes

  • Quantitative assessment parameters:

    • Length of secondary gill lamellae (L1)

    • Diameter of secondary lamellae (D2)

    • Primary diameter of lamellae (D1)

    • Statistical analysis using techniques like two-way ANOVA to evaluate significance

  • Integration with molecular data:

    • Correlation of structural changes with alterations in syvn1 expression or activity

    • Combining histopathology with immunohistochemistry to localize syvn1 protein

    • Parallel analysis of ubiquitination patterns in affected tissues

    • Relating morphological changes to known syvn1 functions in ER stress and quality control

  • Translational implications:

    • Insights into how environmental stressors affect cellular homeostasis mechanisms

    • Understanding of adaptive responses involving protein quality control systems

    • Potential biomarkers for environmental toxicity

    • Models for testing protective interventions targeting syvn1 pathways

This integrated histopathological approach provides a critical bridge between molecular mechanisms and phenotypic outcomes, enhancing our understanding of how syvn1 functions in the context of intact tissues and organismal responses to stress.

What genetic manipulation strategies are most effective for studying syvn1 in zebrafish?

Multiple genetic manipulation strategies can be employed to investigate syvn1 function in zebrafish, each offering distinct advantages for different research questions:

  • CRISPR-Cas9 genome editing:

    • Complete knockout: Targeting early exons to create frameshift mutations

    • Domain-specific mutations: Precise editing of functional domains (RING finger, transmembrane regions)

    • Knock-in approaches: Inserting tags or reporter genes for tracking endogenous syvn1

    • Base editing: Creating specific amino acid changes to study structure-function relationships

  • Morpholino antisense oligonucleotides:

    • Transient knockdown during early development

    • Translation blocking or splice-blocking designs

    • Dose-dependent effects to study partial loss of function

    • Useful for rapid screening before committing to stable genetic lines

  • Transgenic approaches:

    • Overexpression studies using tissue-specific promoters

    • Conditional expression systems (heat shock, Gal4-UAS, Cre-loxP)

    • Fluorescent protein fusions for live imaging of syvn1 dynamics

    • Dominant-negative constructs to disrupt specific functions

  • Experimental workflow for zebrafish syvn1 CRISPR:

StepProcedureTimingCritical Considerations
1Design sgRNAs targeting syvn11-2 daysTarget conserved domains, check off-target potential
2Synthesize sgRNAs and Cas9 protein/mRNA1-2 daysVerify quality by gel electrophoresis
3Microinject into one-cell stage embryos1 dayOptimize injection volume and concentration
4Screen for mutations in F0 founders2-3 monthsUse HRMA, T7E1 assay, or direct sequencing
5Establish F1 germline transmission3-4 monthsOutcross to eliminate potential off-target mutations
6Characterize stable lines2-3 monthsVerify mutation at DNA, RNA, and protein levels
7

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.