Recombinant Danio rerio Elongation of very long chain fatty acids protein 6 (elovl6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
elovl6; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase elovl6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
elovl6
Target Protein Sequence
MSVLALQEYEFERQFNEDEAIRWMQENWKKSFLFSALYAACILGGRHVMKQREKFELRKP LVLWSLTLAAFSIFGAIRTGGYMVNILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAP ELGDTLFIVLRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYLVHAVMYSYYA LRAAGFKISRKFAMFITLTQITQMVMGCVVNYLVYLWMQQGQECPSHVQNIVWSSLMYLS YFVLFCQFFFEAYITKRKSNAAKKSQ
Uniprot No.

Target Background

Function
This endoplasmic reticulum-bound enzyme catalyzes the first and rate-limiting step of the four reactions that constitute the long-chain fatty acids elongation cycle. This process enables the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. As a condensing enzyme, it elongates fatty acids with 12, 14, and 16 carbons with higher activity toward C16:0 acyl-CoAs. It catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with a low desaturation degree. This enzyme may participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Database Links
Protein Families
ELO family, ELOVL6 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Elovl6 in Danio rerio?

Elovl6 (Elongation of very long-chain fatty acids protein 6) in zebrafish primarily functions as a fatty acid elongase that catalyzes the conversion of C16 fatty acids to C18 fatty acids. This elongation activity is critical for maintaining proper fatty acid composition in cellular membranes and lipid metabolism. In zebrafish, Elovl6 plays crucial roles in regulating energy expenditure, lipid homeostasis, and glucose metabolism . Knockout studies have demonstrated that Elovl6 deficiency leads to accumulation of C16 fatty acids (palmitate and palmitoleate) and decreased levels of C18 fatty acids (stearate and oleate), indicating its essential role in fatty acid chain elongation .

How does Elovl6 knockout affect lipid metabolism in zebrafish?

Elovl6 knockout in zebrafish significantly alters lipid metabolism, characterized by:

  • Increased whole-body lipid content compared to wild-type zebrafish

  • Decreased C18/C16 ratio, confirming impaired elongation function

  • Enhanced desaturation activity, evidenced by significant increases in C16:1/C16:0 and C18:1/C18:0 ratios

  • Altered expression of genes and proteins involved in fatty acid degradation, biosynthesis, and PPAR signaling pathways

These metabolic changes demonstrate that Elovl6 is not merely involved in fatty acid elongation but plays a regulatory role in broader lipid homeostasis networks. The knockout model reveals compensatory mechanisms activated when elongation capacity is compromised, including enhanced desaturation activity that likely represents an adaptive response to maintain membrane fluidity and function .

What physiological changes occur in glucose metabolism following Elovl6 knockout in zebrafish?

Elovl6 knockout zebrafish exhibit notable changes in glucose metabolism, with significantly lower fasting blood glucose levels compared to wild-type controls . Transcriptomic and proteomic analyses reveal that this phenotype is associated with alterations in several glucose metabolism pathways, particularly:

  • Glycolysis/gluconeogenesis

  • Insulin signaling pathway

  • PPAR signaling pathway

  • Pyruvate metabolism

Key enzymes such as phosphoenolpyruvate carboxykinase 1 (Pck1), which participates in multiple metabolic pathways including insulin signaling, PPAR signaling, and glycolysis/gluconeogenesis, show differential expression in Elovl6-deficient zebrafish . These findings suggest Elovl6 influences glucose homeostasis through complex regulatory networks that connect lipid metabolism with glucose utilization and production pathways.

How do transcriptomic and proteomic profiles differ in Elovl6 knockout zebrafish compared to wild-type?

Multi-omic analysis of Elovl6 knockout zebrafish revealed significant alterations across transcriptomic and proteomic profiles:

Transcriptomic differences:

  • 734 differentially expressed genes (DEGs) were identified (335 up-regulated, 399 down-regulated)

  • Enriched pathways included fatty acid degradation, biosynthesis, glycolysis/gluconeogenesis, and PPAR signaling

Proteomic differences:

  • 559 differentially expressed proteins (DEPs) were identified (242 up-regulated, 317 down-regulated) from 5525 quantifiable proteins

  • Enriched pathways included steroid hormone biosynthesis, glycolysis/gluconeogenesis, glycerolipid metabolism, pyruvate metabolism, arachidonic acid metabolism, PPAR signaling, biosynthesis of unsaturated fatty acids, and fatty acid metabolism

Integrated analysis:

  • Only 5.0% of up-regulated genes and 4.4% of down-regulated genes showed concordant changes at both transcript and protein levels

  • This limited overlap suggests complex post-transcriptional regulatory mechanisms affecting protein abundance independent of mRNA levels

This multi-layered analysis provides a comprehensive view of how Elovl6 deficiency affects cellular processes, highlighting the importance of integrating different omic approaches to fully understand metabolic adaptations.

What role does Elovl6 play in hematopoietic stem cell function and potential implications for leukemia research?

Recent research demonstrates that Elovl6 is essential for hematopoietic stem cell (HSC) function, with potentially significant implications for leukemia research:

  • Elovl6 transcripts are highly expressed in HSC and hematopoietic progenitor cell (HPC) fractions compared to most peripheral blood cell populations

  • Elovl6 knockout leads to defective HSC engraftment after bone marrow transplantation

  • Elovl6 deficiency blocks acute myeloid leukemia (AML) development in mouse models

  • These effects are attributed, at least partially, to defective chemotaxis due to diminished CXCL12 signaling through the PI3K-RAC pathway

The finding that Elovl6 loss hampers AML propagation suggests that targeting ELOVL6 activity or related downstream pathways could provide novel therapeutic avenues for leukemia treatment . This unexpected connection between fatty acid metabolism and hematopoietic function highlights how Elovl6's role extends beyond basic metabolic processes to influence stem cell behavior and malignant transformation.

What phosphoproteomic changes characterize the Elovl6 knockout phenotype and what kinases are implicated?

Phosphoproteomic analysis of Elovl6 knockout zebrafish identified significant alterations in protein phosphorylation patterns:

  • From 3199 identified phosphoproteins and 8727 phosphosites, 680 differentially expressed phosphoproteins (DEPP) with 1054 modified sites were detected

  • Several key kinases critical for lipid and glucose metabolism were identified, including:

    • Ribosomal protein S6 kinase (Rps6kb)

    • Mitogen-activated protein kinase 14 (Mapk14)

    • V-akt murine thymoma viral oncogene homolog 2-like (Akt2l)

These findings reveal that Elovl6 deficiency impacts not only gene expression and protein abundance but also post-translational modifications that regulate enzyme activity and signaling pathways. The altered phosphorylation status of these kinases suggests that Elovl6 influences metabolic processes through modulation of signaling networks that regulate lipid synthesis, glucose metabolism, and energy homeostasis .

What are the optimal CRISPR/Cas9 approaches for generating Elovl6 knockout zebrafish models?

For generating Elovl6 knockout zebrafish models using CRISPR/Cas9, the following methodological approach has proven effective:

  • Target site selection:

    • The second exon of the Elovl6 gene has been successfully targeted

    • This targeting strategy results in premature stop codons that effectively truncate the protein

  • Guide RNA design:

    • Select target sequences with minimal off-target effects using prediction tools

    • Ensure the target site contains a PAM sequence (NGG for SpCas9)

  • Mutation verification:

    • PCR amplification of the targeted region followed by sequencing

    • In successful knockouts, a "ACTC" deletion has been identified, resulting in premature stop codons

    • This mutation truncates the original 266-amino acid protein to just 46 amino acids

  • Functional validation:

    • Measure Elovl6 mRNA levels in liver tissue to confirm reduced expression

    • Analyze fatty acid composition to verify functional consequences (decreased C18/C16 ratio)

This approach has successfully generated viable Elovl6-deficient zebrafish that exhibit the expected molecular phenotype of impaired C16 to C18 fatty acid elongation, providing a valuable model for studying Elovl6 function in vivo.

What techniques are most effective for analyzing fatty acid profiles in Elovl6 knockout zebrafish?

For comprehensive analysis of fatty acid profiles in Elovl6 knockout zebrafish, the following analytical approach is recommended:

  • Sample preparation:

    • Extract total lipids from whole fish or specific tissues (liver, muscle, etc.)

    • Perform transmethylation to convert fatty acids to fatty acid methyl esters (FAMEs)

  • Analytical methods:

    • Gas chromatography with flame ionization detection (GC-FID) or

    • Gas chromatography-mass spectrometry (GC-MS) for more detailed analysis

  • Key parameters to measure:

    • Individual fatty acid concentrations (particularly C16:0, C16:1, C18:0, C18:1)

    • Calculate important ratios:

      • C18/C16 ratio (indicates elongation activity)

      • C16:1/C16:0 ratio (indicates Δ9-desaturase activity on C16)

      • C18:1/C18:0 ratio (indicates Δ9-desaturase activity on C18)

  • Data interpretation:

    • Decreased C18/C16 ratio confirms impaired elongation function

    • Increased desaturation ratios (C16:1/C16:0 and C18:1/C18:0) indicate compensatory mechanisms

This comprehensive fatty acid analysis provides definitive evidence of Elovl6 functional deficiency and reveals compensatory metabolic adaptations in knockout models.

How can multi-omics approaches be integrated to study Elovl6 function in zebrafish?

Integrating multi-omics approaches to study Elovl6 function in zebrafish provides a comprehensive understanding of its regulatory networks:

  • Transcriptomics (RNA-Seq):

    • Extract total RNA from liver or other relevant tissues

    • Perform RNA-Seq to identify differentially expressed genes

    • Analyze data using principal component analysis (PCA) to evaluate sample clustering

    • Identify enriched pathways using KEGG and GO analyses

  • Proteomics (TMT labeling and LC-MS/MS):

    • Extract and digest proteins from tissues

    • Label peptides with tandem mass tags (TMT)

    • Analyze using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Identify differentially expressed proteins and enriched pathways

  • Phosphoproteomics:

    • Enrich phosphopeptides using TiO₂ or other affinity methods

    • Analyze using LC-MS/MS

    • Identify differentially phosphorylated proteins and affected kinase networks

  • Integration strategies:

    • Compare transcriptomic and proteomic data to identify concordant and discordant changes

    • Categorize genes into different expression patterns (e.g., TrUp-PrUp, TrDown-PrDown)

    • Perform pathway enrichment analysis on integrated datasets

    • Construct protein-protein interaction networks to identify key regulatory hubs

This integrated approach has successfully identified that only about 5% of genes show concordant changes at both transcript and protein levels in Elovl6 knockout zebrafish, highlighting the importance of post-transcriptional regulation in metabolic adaptation .

How do alterations in specific fatty acid ratios relate to the physiological phenotypes observed in Elovl6-deficient zebrafish?

The alterations in fatty acid ratios in Elovl6-deficient zebrafish directly correlate with observed physiological phenotypes through several mechanisms:

  • Decreased C18/C16 ratio and metabolic effects:

    • Confirms impaired elongation function

    • Contributes to altered membrane composition and fluidity

    • Impacts signaling pathways dependent on specific fatty acids

    • Correlates with increased whole-body lipid content and decreased blood glucose

  • Increased desaturation ratios (C16:1/C16:0 and C18:1/C18:0):

    • Represents compensatory increase in Δ9-desaturase activity

    • Helps maintain membrane fluidity despite altered fatty acid chain length

    • May influence insulin sensitivity and glucose metabolism

The relationship between these molecular changes and physiological outcomes can be understood through the altered signaling cascades identified in multi-omic analyses, particularly those involving:

  • PPAR signaling pathway (linking lipid metabolism to transcriptional regulation)

  • Insulin signaling pathway (mediating glucose homeostasis)

  • Phosphorylation changes in key metabolic kinases (Rps6kb, Mapk14, Akt2l)

These findings demonstrate how specific alterations in fatty acid metabolism can propagate through cellular signaling networks to produce systemic physiological effects on lipid storage and glucose homeostasis.

What insights can be gained from comparing Elovl6 knockout phenotypes across different model organisms?

Comparative analysis of Elovl6 knockout phenotypes across different model organisms reveals both conserved and species-specific functions:

Zebrafish (Danio rerio):

  • Increased whole-body lipid content

  • Decreased fasting blood glucose

  • Impaired C16 to C18 fatty acid elongation

  • Enhanced desaturation activity

Mice:

  • Decreased stearate (C18:0) and oleate (C18:1n-9)

  • Increased palmitate (C16:0) and palmitoleate (C16:1n-7)

  • Amelioration of insulin resistance and non-alcoholic steatohepatitis

  • Essential role in hematopoietic stem cell function and leukemia development

Crustaceans (Scylla paramamosain):

  • Multiple isoforms (Elovl6a, Elovl6b, Elovl6c) with tissue-specific expression patterns

  • Differential regulation by dietary fatty acids, salinity, and starvation stress

These cross-species comparisons suggest that while the basic enzymatic function of Elovl6 in fatty acid elongation is conserved, its regulatory roles and physiological implications may vary significantly between species. The divergent phenotypes highlight the importance of studying Elovl6 in multiple model systems to fully understand its biological functions and potential therapeutic applications in human diseases .

How can researchers integrate phosphoproteomic data with other omics datasets to identify key regulatory networks affected by Elovl6 deficiency?

Integrating phosphoproteomic data with other omics datasets to identify key regulatory networks affected by Elovl6 deficiency requires a systematic analytical approach:

  • Identification of differentially phosphorylated proteins:

    • Focus on proteins showing significant changes in phosphorylation status

    • Map these to specific signaling pathways and kinase networks

    • Prioritize proteins with multiple affected phosphosites

  • Cross-platform integration:

    • Match phosphoproteomic data with transcriptomic and proteomic datasets

    • Identify proteins with changes at multiple levels (transcript, protein, phosphorylation)

    • Look for discordant changes that might indicate post-translational regulation

  • Kinase prediction and validation:

    • Use phosphosite sequences to predict responsible kinases

    • Focus on differentially expressed/phosphorylated kinases (e.g., Rps6kb, Mapk14, Akt2l)

    • Validate key findings with targeted kinase assays

  • Network analysis:

    • Construct protein-protein interaction networks centered on phosphorylated proteins

    • Identify network hubs and regulatory bottlenecks

    • Map these networks to affected physiological processes (lipid metabolism, glucose homeostasis)

  • Pathway enrichment analysis:

    • Perform KEGG and GO enrichment on phosphoproteins

    • Compare with pathways enriched in transcriptomic and proteomic datasets

    • Identify common and unique pathways across different omics levels

This integrated approach has successfully revealed how Elovl6 deficiency impacts cellular signaling networks that regulate metabolic processes, providing insights into the complex interplay between fatty acid metabolism, glucose homeostasis, and protein phosphorylation.

What are the potential therapeutic implications of targeting Elovl6 for metabolic and hematological disorders?

The research on Elovl6 function in zebrafish and other models suggests several promising therapeutic directions:

  • Metabolic disorders:

    • Elovl6 inhibition could potentially improve insulin sensitivity, based on reduced blood glucose levels observed in knockout models

    • Targeting specific fatty acid ratios might provide novel approaches for treating metabolic syndrome and related conditions

    • The identified regulatory pathways (PPAR signaling, insulin signaling) offer additional therapeutic targets

  • Hematological malignancies:

    • Elovl6 deficiency blocks acute myeloid leukemia (AML) development in mouse models

    • This suggests that targeting ELOVL6 activity could provide novel treatments for leukemia

    • The connection to CXCL12 signaling through the PI3K-RAC pathway offers potential combination therapy approaches

  • Developmental considerations:

    • Any therapeutic approach would need to balance potential benefits against developmental roles of Elovl6

    • Tissue-specific targeting might be necessary to avoid unwanted effects

These findings highlight how understanding fundamental fatty acid metabolism enzymes like Elovl6 can reveal unexpected therapeutic opportunities across multiple disease areas, from metabolic disorders to cancer.

How might tissue-specific functions of Elovl6 in zebrafish inform understanding of organ-specific metabolic regulation?

Understanding tissue-specific functions of Elovl6 in zebrafish provides important insights into organ-specific metabolic regulation:

  • Liver-specific functions:

    • Primary site of fatty acid metabolism regulation

    • Major contributor to whole-body lipid homeostasis

    • Shows significant transcriptomic, proteomic, and phosphoproteomic changes in Elovl6 knockout

    • Central to glucose metabolism alterations observed in knockout models

  • Hematopoietic tissue functions:

    • High expression in hematopoietic stem cells and progenitor cells

    • Essential for stem cell engraftment and function

    • Influences leukemia development through effects on cell migration

  • Future research directions:

    • Tissue-specific conditional knockout models could help delineate organ-specific functions

    • Cross-tissue communication mediated by fatty acid metabolism could reveal new endocrine regulatory mechanisms

    • Comparative studies between tissues might identify tissue-specific vulnerabilities to Elovl6 deficiency

This organ-specific perspective is critical for understanding how a single enzyme like Elovl6 can have diverse effects throughout the organism, from basic metabolic regulation to complex processes like hematopoiesis and immune function.

What novel experimental approaches could further elucidate the molecular mechanisms linking Elovl6 activity to glucose metabolism?

Several innovative experimental approaches could further clarify the molecular mechanisms connecting Elovl6 activity to glucose metabolism:

  • Advanced metabolic phenotyping:

    • Stable isotope tracing to track carbon flux through glycolysis and fatty acid synthesis

    • In vivo glucose tolerance tests with tissue-specific glucose uptake measurements

    • Hyperinsulinemic-euglycemic clamp studies to assess insulin sensitivity

  • Single-cell multi-omics:

    • Single-cell RNA-seq and proteomics to identify cell-specific responses to Elovl6 deficiency

    • Spatial transcriptomics to map metabolic changes across tissue architecture

    • Combined with lineage tracing to follow developmental impacts

  • Membrane biology approaches:

    • Lipidomic profiling of membrane microdomains

    • Analysis of membrane fluidity and receptor organization

    • Investigation of lipid raft composition and signaling complex formation

  • Targeted protein interaction studies:

    • Proximity labeling techniques to identify Elovl6 protein interactions

    • FRET/BRET approaches to study dynamic protein complexes

    • Structure-function studies of Elovl6 interactions with regulatory proteins

  • In vivo signaling dynamics:

    • Live imaging of signaling reporters in transparent zebrafish larvae

    • Optogenetic control of Elovl6 expression or activity

    • Integration with phosphoproteomic data to validate key signaling nodes

These approaches would provide unprecedented mechanistic insight into how altered fatty acid elongation affects glucose homeostasis, potentially revealing novel regulatory principles connecting lipid metabolism to whole-body energy balance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.