Recombinant Danio rerio Erlin-2 (erlin2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Danio rerio Erlin-2 (erlin2) is a laboratory-engineered form of the zebrafish (Danio rerio) ER lipid raft-associated protein 2, a member of the SPFH (stomatin-prohibitin-flotillin-HflC/K) protein family . This protein is critical in endoplasmic reticulum (ER)-associated degradation (ERAD), regulating cholesterol homeostasis and the ubiquitination of inositol 1,4,5-trisphosphate receptors (IP3Rs) . Its recombinant form enables biochemical and functional studies without requiring native tissue extraction.

Production Systems and Optimization

Recombinant Erlin-2 is produced using diverse platforms, each with distinct advantages:

Host SystemAdvantagesLimitationsYield
YeastCost-effective; supports PTMs Lower yield compared to E. coli0.2–2 mg/mL
E. coliHigh yield; rapid production Lacks eukaryotic PTMs>85% purity
Mammalian CellsNative-like folding and PTMsHigh cost; low scalabilityVariable

Lyophilized formulations in Tris-based buffer with 50% glycerol ensure stability at -20°C .

Biochemical Assays

  • ELISA: Used for antibody validation and protein quantification .

  • Western Blotting: Detected using anti-His or species-specific antibodies .

Disease Mechanism Studies

  • Motor Neuron Diseases: Mutations in ERLIN2 are linked to hereditary spastic paraplegia (SPG18) and amyotrophic lateral sclerosis (ALS) . Recombinant Erlin-2 aids in studying ERAD dysfunction and IP3R overactivation in neurodegeneration .

  • Cholesterol Homeostasis: Erlin-2 regulates ER lipid raft dynamics, impacting cellular cholesterol distribution .

Genetic Mutations and Phenotypic Severity

  • Dominant Mutation (V168M): Causes rapid ALS progression in heterozygous carriers .

  • Recessive Mutation (D300V): Associated with pure hereditary spastic paraplegia .

  • Functional Impact: Loss of Erlin-2 disrupts IP3R degradation, leading to calcium dysregulation and neuronal death .

Comparative Species Analysis

  • Zebrafish vs. Human Erlin-2: Zebrafish Erlin-2 shares 78% sequence identity with human orthologs, making it a viable model for functional studies .

Future Directions

  • Therapeutic Targeting: Screening for compounds that modulate Erlin-2’s interaction with IP3Rs could mitigate neurodegeneration .

  • Structural Studies: Cryo-EM analysis of Erlin-2 complexes may reveal mechanistic details of ERAD .

Recombinant Danio rerio Erlin-2 remains indispensable for dissecting ER lipid raft biology and developing therapies for motor neuron diseases. Its structural conservation with human orthologs underscores its translational relevance .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
erlin2; si:dkey-204l11.2; Erlin-2; Endoplasmic reticulum lipid raft-associated protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
erlin2
Target Protein Sequence
MTLGAVASLILAIGGAAVFSALHKIEEGHVGVYYRGGALLTATSGPGFHLMLPFITTFKSVQTTLQTDEVKNVPCGTGGGVMIYFDRIEVVNYLVPSAVYGIVRNFTADYDKALIFNKVHHELNQFCSVHTLQDVYIGLFDQIDENLKLTLQEDLTSMAPGLIIQAVRVTKPNIPESIRRNYELMESERTKLLIAAQTQKVVEKEAETERKKAVIEAEKVAQVAEIKFGQKVMEKETEKKISQIEDSAYLARQKAKADAEFYSAQRAAEANKLKLTPEYLQLMKFKAIAANSKIYFGSEIPHMFMDSGPGSSSSAASKAIDVLSEGMLDLE
Uniprot No.

Target Background

Function
Erlin-2 mediates endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs) and promotes sterol-accelerated ERAD of HMGCR. It plays a role in regulating cellular cholesterol homeostasis via modulation of the SREBP signaling pathway.
Database Links
Protein Families
Band 7/mec-2 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Q&A

What is ERLIN2 and what are its key structural features?

ERLIN2 (ER Lipid Raft Associated 2) is a protein component of the endoplasmic reticulum (ER) lipid rafts. It belongs to the prohibitin family of proteins but, unlike other family members that localize to mitochondria, plasma membrane, or Golgi vesicles, ERLIN2 specifically localizes to the ER .

The zebrafish (Danio rerio) ERLIN2 protein consists of 331 amino acids and contains an evolutionarily conserved domain characteristic of the prohibitin family . The protein's N-terminus is particularly significant as it contains sequences sufficient for targeting to the ER, even in the absence of classical ER retrieval motifs . The full amino acid sequence of zebrafish ERLIN2 shows characteristic features that enable its function in ER lipid raft domains .

How does recombinant Danio rerio ERLIN2 compare to ERLIN2 from other species?

Recombinant Danio rerio ERLIN2 shares significant structural and functional similarities with ERLIN2 proteins from other species, including humans and Xenopus. All contain the prohibitin domain characteristic of the family and localize to the ER .

What expression systems are used to produce recombinant Danio rerio ERLIN2?

Several expression systems can be used for producing recombinant Danio rerio ERLIN2, each with distinct advantages:

  • Yeast expression system: The most economical and efficient eukaryotic system for secretion and intracellular expression. It allows for post-translational modifications such as glycosylation, acylation, and phosphorylation that ensure native protein conformation .

  • Mammalian cell systems: Produce proteins of very high quality that closely resemble natural proteins, though with higher costs and lower expression levels .

  • E. coli systems: Can be used for producing ERLIN2, though not optimal for proteins requiring eukaryotic post-translational modifications .

  • Cell-free protein synthesis (CFPS): Useful for rapid production of proteins without the constraints of cell viability .

The choice of expression system depends on research requirements for protein purity, post-translational modifications, and downstream applications.

How do mutations in ERLIN2 contribute to neurological disorders?

Mutations in ERLIN2 have been identified in several neurological disorders, particularly those affecting motor neurons:

  • Juvenile Primary Lateral Sclerosis (PLS): A splice junction mutation in ERLIN2 has been identified in juvenile PLS patients, resulting in abnormal splicing of ERLIN2 transcript and nonsense-mediated decay of ERLIN2 mRNA. This leads to exclusive degeneration of upper motor neurons .

  • Hereditary Spastic Paraplegia (HSP): A heterozygous c.212 T>C (p.V71A) variant in exon 8 of ERLIN2 causes pure HSP with juvenile-adolescent onset and gradually worsening symptoms. This variant activates ER stress and affects axonal development .

The mechanisms behind these pathologies involve:

  • Disruption of the ER-associated protein degradation (ERAD) pathway

  • Continuous IP3R signal transduction activation leading to increased calcium release from ER

  • Neuronal hyperactivity eventually resulting in neuronal death

  • Activation of ER stress responses

  • Abnormal axonal development in neurons

These findings underscore the critical role of ERLIN2 in maintaining ER homeostasis and neuronal function.

What is the relationship between ERLIN2 and ER stress in neurodegenerative diseases?

ERLIN2 plays a crucial role in regulating ER stress responses, with significant implications for neurodegenerative diseases:

  • ERLIN2 mediates the ER stress response to protein misfolding, as observed in breast cancer cells and potentially applicable to neuronal tissues .

  • Mutations or dysfunction in ERLIN2 can lead to protein accumulation that triggers ER stress under pathological circumstances .

  • Motor neurons are particularly sensitive to ER stress due to their high activity levels, explaining why ERLIN2 mutations often manifest as motor neuron diseases .

  • Studies have suggested that ER stress increases in the early stages of amyotrophic lateral sclerosis (ALS), indicating a potential common pathway with other ERLIN2-related motor neuron diseases .

  • The absence of membralin-ERLIN2 interaction increases basal ER stress, resulting in ER stress-induced cell death .

These observations suggest that ERLIN2's role in regulating ER stress makes it a critical factor in neurodegeneration, particularly in motor neuron diseases where ER stress mechanisms may represent potential therapeutic targets.

How does ERLIN2 function in the ERAD pathway and calcium homeostasis?

ERLIN2 functions as a key component of the endoplasmic reticulum-associated protein degradation (ERAD) pathway with specific roles in calcium homeostasis:

  • ERLIN2 binds to activated inositol trisphosphate receptors (IP3Rs) and mediates their polyubiquitination and subsequent degradation .

  • It also assists in the degradation of 3-hydroxy-3-methylglutaryl-CoA reductase, demonstrating its broader role in protein quality control .

  • When ERLIN2 is mutated or dysfunctional, it causes continuous IP3R signal transduction activation, leading to increased calcium release from the ER .

  • This dysregulation of calcium homeostasis can trigger neuronal hyperactivity and eventually lead to neuron death, explaining the neurodegenerative phenotypes associated with ERLIN2 mutations .

  • ERLIN2's localization to ER lipid rafts is significant, as these specialized membrane domains likely serve as organizing centers for ERAD machinery and calcium regulatory proteins .

The dual role of ERLIN2 in protein quality control and calcium regulation highlights its importance in maintaining ER homeostasis and neuronal function.

What are the optimal experimental approaches for studying recombinant Danio rerio ERLIN2?

When studying recombinant Danio rerio ERLIN2, several methodological approaches can be employed:

  • Expression and Purification:

    • Yeast expression systems offer the best balance between protein quality and yield for zebrafish ERLIN2

    • Purification via His-tag affinity chromatography allows for high purity (>90%)

    • Storage in Tris-based buffer with 50% glycerol at -20°C prevents protein degradation

  • Functional Assays:

    • Enzyme-linked immunosorbent assay (ELISA) for protein-protein interaction studies

    • Cell culture models using NSC34 cells for knockdown studies to observe effects on cell growth and survival

    • Immunofluorescence (IF) to study ERLIN2 localization in the ER and its impact on ER morphology

  • Genetic Analysis:

    • Reverse transcription-PCR (RT-PCR) to measure ERLIN2 mRNA levels and detect splicing abnormalities

    • Whole-exome sequencing and Sanger sequencing for identification of variants in ERLIN2 gene

    • Analysis of XBP-1S mRNA levels as a marker of ER stress activation

  • Neuronal Models:

    • Primary cultured cortical neurons for studying the effects of ERLIN2 variants on axon growth and development

    • Short-hairpin RNA interference for knockdown studies in neuronal cell lines

These methodologies provide complementary approaches to understand the structure, function, and pathological implications of zebrafish ERLIN2 in various cellular contexts.

How can one effectively design ERLIN2 knockdown experiments in zebrafish models?

Designing effective ERLIN2 knockdown experiments in zebrafish models requires careful consideration of several factors:

  • Knockdown Strategy Selection:

    • Morpholino oligonucleotides (MOs): Target ERLIN2 mRNA translation start site or splice junctions

    • CRISPR/Cas9 gene editing: For generating stable knockout lines

    • Short-hairpin RNA interference: For tissue-specific or inducible knockdown

  • Validation of Knockdown Efficiency:

    • Quantitative real-time PCR to measure ERLIN2 mRNA levels

    • Western blot analysis to confirm protein reduction

    • RT-PCR to detect abnormal splicing if targeting splice junctions

  • Phenotypic Analysis:

    • Motor behavior assessment: Swimming patterns, response to stimuli, and escape behaviors

    • Microscopic examination of motor neuron development and axonal growth

    • Assessment of ER stress markers such as XBP-1S expression levels

  • Control Experiments:

    • Use of scrambled/control MOs or guide RNAs

    • Rescue experiments by co-injecting wild-type ERLIN2 mRNA

    • Comparison with established neurological disease models

  • Downstream Analysis:

    • Cell growth assays based on findings that ERLIN2 knockdown suppresses cell growth in culture

    • ER morphology examination using fluorescent markers

    • Calcium imaging to assess IP3R-mediated calcium release

Based on previous research with NSC34 cells, investigators should anticipate that ERLIN2 knockdown may suppress cell growth and potentially induce ER stress responses similar to those observed in neurological disease models .

What purification and quality control methods are recommended for recombinant Danio rerio ERLIN2?

Ensuring high purity and functionality of recombinant Danio rerio ERLIN2 requires rigorous purification and quality control methods:

  • Purification Strategies:

    • Affinity chromatography using His-tag fusion proteins is the primary method, yielding >90% purity

    • Size exclusion chromatography (SEC) for further purification and oligomeric state determination

    • Ion exchange chromatography as an additional step for removing contaminants

  • Quality Control Methods:

    • SDS-PAGE and Western blotting to confirm protein identity and estimate purity

    • Mass spectrometry for accurate molecular weight determination and sequence verification

    • Analytical SEC (HPLC) to assess protein homogeneity and aggregation state

    • Anti-tag ELISA to verify tag accessibility and functionality

  • Functional Verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Binding assays to confirm interaction with known ERLIN2 partners like IP3Rs

  • Storage and Handling:

    • Lyophilization for long-term storage

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Storage at -20°C for extended periods, with working aliquots kept at 4°C for up to one week

    • Use of Tris-based buffer with 50% glycerol as a stabilizing agent

These methods ensure that the recombinant protein maintains its native conformation and functional properties, critical for reliable experimental outcomes in studies of ERLIN2 structure and function.

What considerations are important when analyzing ERLIN2's role in zebrafish neurodevelopment?

When analyzing ERLIN2's role in zebrafish neurodevelopment, researchers should consider several key factors:

  • Developmental Timing:

    • ERLIN2 expression patterns throughout different developmental stages

    • Critical periods when ERLIN2 function most significantly impacts neuronal development

    • Comparison with mammalian developmental timelines for translational relevance

  • Neuronal Specificity:

    • Focus on motor neurons given ERLIN2 mutations' association with motor neuron diseases

    • Differentiate between effects on upper vs. lower motor neurons

    • Investigate potential non-motor neuron effects for comprehensive understanding

  • Cellular Mechanisms:

    • Analyze ER stress responses during normal development versus pathological conditions

    • Examine axon growth parameters, as ERLIN2 variants affect axonal development

    • Investigate calcium signaling dynamics, given ERLIN2's role in IP3R regulation

  • Molecular Interactions:

    • Map ERLIN2 interaction partners in the developing nervous system

    • Analyze how ERLIN2's participation in the ERAD pathway affects neurodevelopment

    • Investigate membrane domain organization in developing neurons

  • Experimental Controls:

    • Compare with other ER stress models to distinguish ERLIN2-specific effects

    • Use multiple methodologies (genetic, pharmacological) to confirm observations

    • Include rescue experiments to verify causality of observed phenotypes

The overexpression of ERLIN2 variants in primary cultured cortical neurons has been shown to promote axon growth, suggesting a critical role in neuronal development that warrants careful analysis in zebrafish models .

How should researchers interpret conflicting results between in vitro and in vivo ERLIN2 studies?

When faced with conflicting results between in vitro and in vivo ERLIN2 studies, researchers should implement a systematic interpretative framework:

  • System Complexity Considerations:

    • In vitro systems (like NSC34 cells) lack the complex cellular environment of whole organisms

    • Zebrafish in vivo studies incorporate developmental, systemic, and compensatory mechanisms absent in cell culture

    • Consider that ERLIN2 knockdown suppresses cell growth in culture, but effects may manifest differently in vivo due to compensatory mechanisms

  • Methodological Analysis:

    • Evaluate differences in protein expression levels between systems (overexpression vs. physiological)

    • Consider the impact of different knockdown/knockout strategies (acute vs. chronic loss)

    • Assess whether different domains or functions of ERLIN2 are being examined across studies

  • Temporal Dynamics:

    • Early developmental effects may differ from adult phenotypes

    • Acute responses to ERLIN2 manipulation may contrast with long-term adaptations

    • ER stress responses follow distinct temporal patterns that may be captured differently in various models

  • Resolution Strategies:

    • Perform parallel experiments in both systems using identical ERLIN2 variants or manipulations

    • Develop intermediate models (e.g., organoids, ex vivo preparations) to bridge the gap

    • Use conditional/inducible systems to separate developmental from functional effects

    • Employ rescue experiments with wild-type and mutant forms to identify specific functional domains

  • Integrated Interpretation:

    • Recognize that seemingly conflicting results may reveal different aspects of ERLIN2 biology

    • Consider that mutations affecting ER stress and axonal development in neurons may have distinct manifestations in different contexts

    • Develop unified models that incorporate both cell-autonomous and system-level effects

This systematic approach enables researchers to extract valuable insights from apparently contradictory findings and develop more comprehensive models of ERLIN2 function.

What bioinformatic approaches are most useful for analyzing ERLIN2 across species?

Bioinformatic approaches provide powerful tools for analyzing ERLIN2 across species, revealing evolutionary conservation and functional domains:

  • Sequence Analysis Tools:

    • Multiple sequence alignment to compare ERLIN2 sequences across species (zebrafish, humans, Xenopus)

    • Phylogenetic analysis to understand evolutionary relationships of ERLIN2

    • Conservation scoring to identify functionally critical residues

    • Motif analysis to detect targeting signals, particularly in the N-terminal region critical for ER localization

  • Structural Bioinformatics:

    • Homology modeling to predict three-dimensional structures of ERLIN2 from different species

    • Molecular dynamics simulations to analyze the impact of disease-associated mutations

    • Protein-protein interaction interface prediction for ERLIN2's interaction with IP3Rs and other partners

    • Analysis of the prohibitin domain shared by ERLIN family members

  • Functional Genomics Integration:

    • Expression pattern comparison across species and tissues

    • Cross-species pathway analysis focusing on ERAD and ER stress response pathways

    • Correlation of genetic variants with disease phenotypes across model organisms

    • Gene ontology enrichment analysis of ERLIN2-associated gene networks

  • Variant Analysis:

    • Prediction of pathogenicity for variants like c.212 T>C using tools like SIFT, PolyPhen, and CADD

    • Comparison of variant effects across orthologs

    • Splice site analysis for mutations affecting ERLIN2 transcript processing

    • Population genetics approaches to assess variant frequency and selection pressure

  • Database Integration:

    • Utilization of species-specific databases (ZFIN for zebrafish)

    • Disease databases (OMIM, ClinVar) for human ERLIN2 variants

    • Protein interaction databases to map conserved interaction networks

    • Structural databases for domain annotation and comparison

These bioinformatic approaches enable researchers to leverage cross-species information to better understand ERLIN2 function and predict the impact of variants in research and clinical contexts.

What are the most promising research directions for Danio rerio ERLIN2 studies?

Future research on Danio rerio ERLIN2 shows great promise in several directions that could significantly advance our understanding of neurological disorders and ER biology:

  • Neurodegenerative Disease Modeling:

    • Development of zebrafish models harboring human disease-associated ERLIN2 variants

    • Utilization of zebrafish transparency to visualize ER stress responses in living neurons

    • High-throughput screening for compounds that rescue ERLIN2-associated neurological phenotypes

  • ER Lipid Raft Biology:

    • Characterization of the unique properties of ER lipid rafts containing ERLIN2

    • Investigation of the evolutionary conservation of ER lipid raft composition and function

    • Analysis of how ERLIN2 contributes to specialized ER domain formation and maintenance

  • Calcium Signaling and Neuronal Function:

    • Real-time imaging of calcium dynamics in zebrafish neurons with altered ERLIN2 function

    • Electrophysiological characterization of neurons with ERLIN2 mutations

    • Investigation of the relationship between IP3R regulation by ERLIN2 and neuronal excitability

  • Therapeutic Approaches:

    • Development of strategies to modulate ER stress in ERLIN2-associated diseases

    • Gene therapy approaches targeting ERLIN2 or compensatory pathways

    • Identification of small molecules that can restore normal ERLIN2 function or compensate for its loss

  • Developmental Biology:

    • Detailed characterization of ERLIN2's role in axonal development and guidance

    • Investigation of potential interactions between ERLIN2 and other developmental signaling pathways

    • Analysis of how ERLIN2-dependent processes shape neuronal circuit formation

The zebrafish model offers unique advantages for these studies, including rapid development, genetic tractability, and optical transparency, making it an ideal system for advancing our understanding of ERLIN2 biology and related neurological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.