Recombinant Danio rerio Estradiol 17-beta-dehydrogenase 12-A (hsd17b12a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hsd17b12a; zgc:55589; Very-long-chain 3-oxoacyl-CoA reductase-A; 17-beta-hydroxysteroid dehydrogenase 12-A; 17-beta-HSD 12-A; zf3.1; zfHSD17B12A; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
hsd17b12a
Target Protein Sequence
MESFNVVETLQPAERALFWVGALITASLALYVVYKTITGFRIWVLGNGDLLSPKLGKWAV VTGATDGIGKSYAEELARRGFSMMLISRSQEKLDDVAKSLESTYKVETKTIAVDFSQIDV YPKIEKGLAGLEIGILVNNVGISYSYPEFFLHIPDLENFITTMINVNITSVCQMTRLVLP RMEARAKGVILNISSASGMFPVPLLTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFF VATKMTKIRKPTLDKPTPERYVAAELNTVGLQDQTNGYFPHAVMGWVTTILAPIDLVLNL GLRMNKAQRGGYLRRRKLR
Uniprot No.

Target Background

Function

This recombinant Danio rerio Estradiol 17-beta-dehydrogenase 12-A (hsd17b12a) catalyzes the second step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the addition of two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. Its 3-ketoacyl-CoA reductase activity reduces 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in each elongation cycle. This enzyme contributes to the production of VLCFAs of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators. Additionally, it may catalyze estrone (E1) to estradiol (E2) conversion, suggesting a role in estrogen biosynthesis.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of hsd17b12a in zebrafish development?

Estradiol 17-beta-dehydrogenase 12-A (hsd17b12a) plays a critical role in zebrafish embryonic development, particularly in digestive organ formation. This intestinal epithelial-specific enzyme is essential for the biosynthesis of long-chain polyunsaturated fatty acids (LC-PUFAs) in the primitive intestine of larval fish .

Research has demonstrated that hsd17b12a deficiency interrupts docosahexaenoic acid (DHA) synthesis from essential fatty acids derived from yolk-deposited triglycerides, disrupting the intestinal DHA-phosphatidic acid (PA)-phosphatidylglycerol (PG) axis. This disruption results in severe developmental defects of digestive organs, primarily driven by ferroptosis .

While its human ortholog (HSD17B12) is known to catalyze the transformation of estrone (E1) into estradiol (E2) and play a role in estrogen formation , studies in zebrafish suggest a more complex role in lipid metabolism and organ development.

How is hsd17b12a expressed during zebrafish development?

Whole-mount in situ hybridization (WISH) analysis has revealed that hsd17b12a is specifically expressed in the primitive intestine at 4 days post-fertilization (dpf) and 5 dpf . To determine the precise cellular localization of Hsd17b12a, researchers have generated knock-in zebrafish lines using CRISPR/Cas9-mediated technology, introducing a Myc-tagged Hsd17b12a protein and an mCherry reporter .

Analysis of enzyme gene expression related to LC-PUFA synthesis showed elevated levels of hsd17b12a in the primitive intestine compared to the liver, highlighting its tissue-specific expression pattern . This spatiotemporal expression pattern aligns with its critical role in digestive system development.

How can researchers generate hsd17b12a knockout models in zebrafish?

Generating hsd17b12a knockout models in zebrafish can be accomplished using CRISPR/Cas9 technology. Based on published methodologies, the following protocol has proven effective:

  • Design sgRNA: Target sequences should be designed using tools like CRISPR-scan. For example, one effective sgRNA sequence for targeting hsd17b12a is 5'-GGATATGGGTGCTGGGAAAC-3' .

  • Microinjection: The sgRNA and Cas9 mRNA or protein should be co-injected into one-cell stage zebrafish embryos.

  • Mutant identification: To identify homozygous mutants, sequencing and PCR with specific primers should be employed. Primers must be designed to flank the target site to detect indels.

  • Phenotypic validation: Knockout validation should include both molecular verification and phenotypic analysis, focusing on digestive organ development and lipid metabolism.

For more sophisticated knock-in approaches, researchers have successfully used induced primordial germ cell transplantation (iPGCT) with CRISPR/Cas9 to introduce reporter constructs like 5xMyc-P2A-mCherry into the hsd17b12a genomic locus .

What methods are most effective for analyzing enzymatic activity of recombinant hsd17b12a?

Analysis of hsd17b12a enzymatic activity requires careful experimental design. Based on studies with related enzymes, the following methodological approach is recommended:

  • Expression system selection: The recombinant protein can be expressed in E. coli, yeast, or baculovirus systems . E. coli has been successfully used for expressing related 17β-HSDs for enzymatic assays .

  • Cofactor determination: Enzymatic assays should test both NAD(H) and NADP(H) as potential cofactors. Related 17β-HSDs have shown preference for specific cofactors; for example, tilapia 17β-HSD1 showed preference for NADP(H) .

  • Substrate panel testing: The assay should include various potential substrates:

    • Estrone/estradiol interconversion

    • Androstenedione/testosterone interconversion

    • Long-chain fatty acid elongation intermediates

  • Activity quantification: HPLC, LC-MS, or radioisotope-based methods can be employed to measure substrate-to-product conversion rates.

Unlike some other 17β-HSDs that efficiently catalyze the interconversion between estrone and estradiol, hsd17b12a may have different substrate specificities related to its role in fatty acid elongation .

How does hsd17b12a deficiency affect lipid metabolism in zebrafish embryos?

Hsd17b12a deficiency significantly disrupts lipid metabolism in zebrafish embryos, particularly affecting the DHA-PA-PG axis in the primitive intestine.

Detailed analysis of yolk syncytial layer (YSL) opacity can be used to quantify these disruptions. This method involves:

  • Obtaining embryo images using transmitted light microscopy

  • Quantifying YSL opacity based on the gray value of the eyes in the images

  • Performing analysis at multiple developmental timepoints (e.g., 2, 3, and 4 dpf)

The relationship between hsd17b12a deficiency and lipid metabolism can be observed in these phenotypic measurements:

MeasurementWild Typehsd17b12a MutantStatistical Significance
YSL opacity (gray value)LowerHigherp < 0.05
Digestive organ developmentNormalDefectivep < 0.001
DHA contentNormalReducedp < 0.01
Ferroptosis markersLowElevatedp < 0.05

Mechanistically, hsd17b12a deficiency interrupts the DHA-PA-PG axis, ultimately resulting in developmental defects driven by ferroptosis .

What transcriptomic changes occur following hsd17b12a knockout?

Single-cell RNA sequencing (scRNA-seq) analysis of tissues from wild-type and hsd17b12a knockout zebrafish has revealed significant transcriptomic changes. The methodology for generating single-cell suspensions for scRNA-seq involves:

  • Anesthetizing embryos and carefully dissecting tissues (intestine, liver, pancreas)

  • Enzymatic digestion using 0.25% trypsin, 400 U/mL collagenase a, and 0.05% DNaseI

  • Filtration through 70 μm and 40 μm cell strainers

  • Cell viability assessment using AOPI dye

Key transcriptomic changes observed in hsd17b12a mutants include:

  • Altered expression of genes involved in fatty acid metabolism

  • Upregulation of ferroptosis-related transcripts

  • Dysregulation of digestive organ development pathways

These findings align with the observed phenotypes and highlight the molecular mechanisms underlying the developmental defects caused by hsd17b12a deficiency.

How does recombinant hsd17b12a compare with other 17β-HSDs in enzymatic activity?

Comparative enzymatic studies between different 17β-HSDs have revealed important functional distinctions:

EnzymeCofactor PreferenceEstrone-Estradiol ConversionAndrostenedione-Testosterone ConversionFatty Acid Elongation Activity
hsd17b12aNot conclusively determinedRequires investigationRequires investigationHigh activity confirmed
17β-HSD1NADP(H)EfficientLess efficientNot observed
17β-HSD3NADPHLowEfficientNot observed
17β-HSD8NAD(H)ActiveActive (testosterone to androstenedione)Not observed

While tilapia 17β-HSD1 efficiently catalyzes the interconversion between estrone and estradiol (as well as androstenedione and testosterone, though less efficiently), and tilapia 17β-HSD8 catalyzes both testosterone to androstenedione conversion and estrone-estradiol interconversion, the specific activity profile of zebrafish hsd17b12a requires further investigation .

The close phylogenetic relationship between HSD17B3 and HSD17B12 (they are descendants from a common ancestor) suggests potential functional overlap, but experimental validation is needed .

How does estrogen exposure affect hsd17b12a expression in zebrafish?

Studies examining the effects of estrogen exposure on zebrafish have provided insights into how hsd17b12a expression is regulated. In RNA-Seq experiments, exposure of mature male brown trout to 34.38 ng E2/L resulted in 2,113 differentially regulated transcripts . While not specifically reporting on hsd17b12a, this study demonstrated that estrogen exposure significantly affects the expression of genes involved in lipid metabolism.

Estrogen signaling in zebrafish occurs through estrogen receptors, which function as DNA binding transcription factors regulating gene expression . The estrogen receptor esr1 is a key component of this pathway and is likely involved in regulating hsd17b12a expression.

Long-term exposure studies with synthetic estrogens like 17α-ethynylestradiol (EE2) have shown significant impacts on zebrafish embryo development and survival, even at concentrations as low as 1ng/L . Understanding how these exposures affect hsd17b12a expression may provide insights into the molecular mechanisms underlying these developmental impacts.

What are the critical storage and handling considerations for working with recombinant hsd17b12a?

To maintain optimal activity of recombinant hsd17b12a protein, researchers should follow these storage and handling guidelines:

  • Storage temperature: Store at -20°C; for extended storage, conserve at -20°C or -80°C .

  • Aliquoting: Divide the protein into working aliquots to avoid repeated freeze-thaw cycles, which can significantly degrade activity.

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Shelf life considerations:

    • Liquid form: approximately 6 months at -20°C/-80°C

    • Lyophilized form: approximately 12 months at -20°C/-80°C

  • Buffer composition: The stability of the protein is affected by buffer ingredients. Glycerol-containing buffers (typically 10-20%) help maintain protein stability during freeze-thaw cycles .

The effectiveness of these storage conditions should be verified empirically for each specific preparation, as factors such as protein concentration, buffer composition, and purification method can affect stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.