Recombinant Danio rerio Estradiol 17-beta-dehydrogenase 12-B (hsd17b12b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
hsd17b12b; zgc:73289; Very-long-chain 3-oxoacyl-CoA reductase-B; 17-beta-hydroxysteroid dehydrogenase 12-B; 17-beta-HSD 12-B; zf3.3; zfHSD17B12B; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
hsd17b12b
Target Protein Sequence
MEPFADALFWVGAVTVLWLSVSSLWSLINGIRVWILGNGNLMRASSLGKWAVVTGATDGI GKAYAEELARRGFAIVLISRTQEKLDEVSKAIESKYKVETKTISADFGSVDIYPKIESGL AGLEIGVLVNNVGVSYSYPEFFLNIPDVDSFINNMININIMSVCQMTRLVLPRMVDRSKG VILNVASASGMYPVPLLTLYSSTKAFVDFFSRGLDAEYKSKGIIIQSVLPFYVTTKLSKI RKPTLDIPTPERYVKAQLSTIGLQTQSNGYLPHAIMGWVTASLLPAKLLNKYVMGMGLSQ RARYLKKQKQG
Uniprot No.

Target Background

Function

This enzyme catalyzes the second step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound process adds two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. Its 3-ketoacyl-CoA reductase activity reduces 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in each cycle. This participation in VLCFA biosynthesis contributes to the production of various chain lengths involved in diverse biological processes, serving as precursors for membrane lipids and lipid mediators. Additionally, it may catalyze estrone (E1) conversion to estradiol (E2), indicating a role in estrogen synthesis.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the genomic characterization of hsd17b12b in zebrafish?

Hydroxysteroid (17-beta) dehydrogenase 12b (hsd17b12b) is a protein-coding gene located on chromosome 7 in zebrafish. It is identified with the ZDB-GENE-030131-1346 ID in genomic databases. The gene has previously been annotated as fb68b12, wu:fb68b12, zf 3.3, and zgc:73289. Its mRNA transcript (hsd17b12b-201) contains 2,297 nucleotides as annotated by Ensembl . The protein is predicted to have 311 amino acids in length, as confirmed in UniProtKB entries A7MCK2 and Q6QA33 .

What are the predicted molecular functions of hsd17b12b?

Hsd17b12b is predicted to have estradiol 17-beta-dehydrogenase activity and is involved in several biological processes including:

  • Estrogen biosynthetic process

  • Fatty acid biosynthetic process

  • Steroid biosynthetic process

The protein contains domains from the NAD(P)-binding domain superfamily, short-chain dehydrogenase/reductase SDR, and VLCFA Elongation and Steroid Dehydrogenase families . It is orthologous to human HSD17B12 (hydroxysteroid 17-beta dehydrogenase 12), suggesting functional conservation across vertebrate species .

What is the subcellular localization of hsd17b12b?

Based on current annotations, hsd17b12b is predicted to be localized in the endoplasmic reticulum membrane and active within the endoplasmic reticulum . This localization is consistent with its predicted involvement in lipid metabolism and steroid biosynthesis, as these processes are known to occur partially in the endoplasmic reticulum. Similar enzymes in the 17-beta-hydroxysteroid dehydrogenase family are typically membrane-associated proteins involved in lipid and steroid metabolism .

What is the expression pattern of hsd17b12b during zebrafish development?

Hsd17b12b shows expression in several anatomical structures in zebrafish, including:

  • Eye

  • Heart

  • Integument

  • Liver

  • Pleuroperitoneal region

Expression data from the Zebrafish Information Network (ZFIN) indicates that there are 4 figures from 3 publications documenting the expression pattern of this gene . The gene shows a relatively ubiquitous expression pattern during embryogenesis, similar to what has been observed for HSD17B3 candidate genes .

How does hsd17b12b function differ from its paralog hsd17b12a in zebrafish developmental processes?

While both hsd17b12a and hsd17b12b are paralogs in zebrafish, they appear to have distinct functional roles during development. Recent research indicates that hsd17b12a is specifically expressed in intestinal epithelial cells and is essential for the biosynthesis of long-chain polyunsaturated fatty acids (LC-PUFAs) in the primitive intestine of larval fish . In contrast, hsd17b12b shows a broader expression pattern across multiple tissues .

The deficiency of hsd17b12a leads to severe developmental defects in the primitive intestine and exocrine pancreas through disruption of docosahexaenoic acid (DHA) synthesis from essential fatty acids derived from yolk-deposited triglycerides . This ultimately affects the DHA-phosphatidic acid (PA)-phosphatidylglycerol (PG) axis, resulting in developmental defects primarily driven by ferroptosis .

Researchers investigating functional differences between these paralogs should consider:

  • Conducting tissue-specific knockout or knockdown experiments

  • Performing rescue experiments with each paralog in deficient models

  • Analyzing tissue-specific metabolomic profiles to identify differential metabolic outputs

What methodologies are recommended for expressing and purifying recombinant hsd17b12b for in vitro enzymatic studies?

For successful expression and purification of recombinant hsd17b12b, the following methodological approach is recommended:

  • Expression System Selection:

    • Bacterial (E. coli) systems may be suitable for basic structural studies but may lack post-translational modifications

    • Insect cell (Sf9, Sf21) systems are recommended for enzymes requiring proper folding

    • Mammalian expression systems (HEK293, CHO) should be considered for studies requiring native-like activity

  • Construct Design:

    • Include an N- or C-terminal purification tag (His6, GST)

    • Consider removing the predicted transmembrane domain for improved solubility

    • Optimize codon usage for the chosen expression system

  • Purification Protocol:

    • Initial capture using affinity chromatography (IMAC for His-tagged proteins)

    • Secondary purification using ion exchange chromatography

    • Final polishing step using size exclusion chromatography

    • Use detergents (0.1% DDM or CHAPS) in all buffers to maintain stability of this membrane-associated protein

  • Activity Verification:

    • Measure estradiol 17-beta-dehydrogenase activity using NADPH-dependent reduction assays

    • Monitor conversion of estrone to estradiol using HPLC or LC-MS/MS

    • Use fatty acid elongation assays to assess very-long-chain fatty acid biosynthetic activity

How can researchers assess the enzymatic activity of hsd17b12b in zebrafish models?

Assessment of hsd17b12b enzymatic activity in zebrafish models can be approached through several complementary methods:

  • In vivo activity measurements:

    • Transgenic reporter systems incorporating estrogen-responsive elements

    • Metabolomic profiling of steroid hormones and fatty acids in wild-type versus hsd17b12b mutant fish

    • Analysis of LC-PUFA levels in specific tissues using LC-MS/MS

  • Ex vivo tissue-based assays:

    • Microsomal fraction isolation from specific tissues (liver, gonads)

    • Incubation with radiolabeled or stable isotope-labeled substrates

    • Quantification of conversion rates using chromatographic methods

  • Genetic approaches:

    • CRISPR-Cas9 mediated knockout of hsd17b12b

    • Morpholino knockdown for temporally controlled studies

    • Rescue experiments with wild-type or mutated recombinant protein

  • Protein-substrate interaction studies:

    • Proximity labeling techniques to identify interaction partners

    • Structural modeling of the substrate binding pocket

    • Mutation of key residues predicted to affect substrate specificity

Studies of hsd17b12 homologs suggest measuring both estradiol dehydrogenase activity and very-long-chain fatty acid elongation activity, as the enzyme appears to function in both pathways .

What are the implications of hsd17b12b in zebrafish lipid metabolism compared to its human ortholog?

The human ortholog of zebrafish hsd17b12b, HSD17B12, has been identified as involved in long-chain fatty acid elongation, particularly in the production of arachidonic acid . In zebrafish, research on the related hsd17b12a indicates a crucial role in the biosynthesis of long-chain polyunsaturated fatty acids, particularly docosahexaenoic acid (DHA) .

Comparative functional analysis suggests:

  • Conserved metabolic pathways:

    • Both human and zebrafish proteins appear involved in fatty acid elongation

    • Both may participate in steroid metabolism pathways

    • Both are localized to the endoplasmic reticulum membrane

  • Potential divergences:

    • Zebrafish have two paralogs (hsd17b12a and hsd17b12b) that may have undergone subfunctionalization

    • Tissue-specific expression patterns may differ between species

    • Substrate preferences may have evolved differently

  • Methodological considerations for comparative studies:

    • Use of metabolic labeling with stable isotopes to track fatty acid flux

    • Lipidomic profiling of mutant models in both species

    • Heterologous expression systems to directly compare enzyme kinetics

Recent findings indicate that human HSD17B12 functions as a host factor for flavivirus replication , raising interesting questions about whether zebrafish hsd17b12b might play similar roles in viral susceptibility.

What are the optimal conditions for expressing recombinant hsd17b12b in bacterial systems?

For optimal expression of recombinant hsd17b12b in bacterial systems, researchers should consider the following protocol:

  • Vector selection:

    • pET series vectors with T7 promoter for high-level expression

    • Consider using pET-SUMO or pET-MBP vectors to enhance solubility

    • Include C-terminal His6 tag for purification

  • Expression strain optimization:

    • E. coli BL21(DE3) as the standard expression host

    • BL21(DE3)pLysS for better control of basal expression

    • Rosetta(DE3) strains if zebrafish codon usage is problematic

  • Culture conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Induction with 0.1-0.5 mM IPTG

    • Post-induction temperature shift to 16-18°C for 16-20 hours

    • Supplementation with 0.1-0.5% glucose to prevent leaky expression

  • Protein extraction considerations:

    • Use mild detergents (0.5-1% Triton X-100) in lysis buffer

    • Include 10% glycerol to enhance stability

    • Consider extraction in the presence of lipid substrates or cofactors

  • Solubility enhancement strategies:

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Truncation of transmembrane domains if present

    • Addition of specific detergents during lysis (CHAPS, DDM)

Experimental validation should include western blot analysis to confirm expression and activity assays to verify functional protein production.

How should researchers design CRISPR-Cas9 knockout models for hsd17b12b functional studies?

Designing effective CRISPR-Cas9 knockout models for hsd17b12b requires careful consideration of several key factors:

  • Guide RNA (gRNA) design:

    • Target conserved functional domains (NAD(P)-binding domain, short-chain dehydrogenase/reductase domain)

    • Use multiple prediction algorithms to identify gRNAs with high on-target efficiency and low off-target effects

    • Consider targeting early exons to ensure complete loss-of-function

    • Multiple gRNAs can be used simultaneously to create larger deletions

  • Delivery method optimization:

    • Microinjection of gRNA and Cas9 mRNA or protein into 1-cell stage embryos

    • Concentration titration (25-50 pg gRNA, 150-300 pg Cas9 mRNA)

    • Consider using zebrafish-optimized Cas9 variants for higher efficiency

  • Mutation screening strategies:

    • T7E1 or heteroduplex mobility assays for initial screening

    • Direct sequencing of PCR products for precise mutation characterization

    • High-resolution melting analysis for high-throughput screening

    • qPCR for evaluating potential off-target effects

  • Functional validation approaches:

    • RT-qPCR to confirm transcript reduction

    • Western blot to confirm protein loss (if antibodies available)

    • Rescue experiments with wild-type mRNA to confirm phenotype specificity

    • Phenotypic analysis focusing on tissues with known expression

  • Considerations for potential compensatory mechanisms:

    • Monitor expression of hsd17b12a and other related family members

    • Consider generating double knockouts if compensation is suspected

    • Use conditional knockout approaches if complete knockouts are lethal

Based on findings from hsd17b12a studies, researchers should particularly monitor digestive organ development, lipid metabolism, and DHA synthesis pathways when characterizing hsd17b12b mutants .

What bioinformatic approaches are recommended for comparing hsd17b12b between different teleost species?

For comprehensive comparative analysis of hsd17b12b across teleost species, researchers should employ the following bioinformatic approaches:

  • Sequence retrieval and alignment:

    • Retrieve sequences from genomic databases (Ensembl, NCBI)

    • Use BLAST to identify potential orthologs in species lacking annotation

    • Perform multiple sequence alignment using MUSCLE, MAFFT, or T-Coffee

    • Identify conserved domains and catalytic residues

  • Phylogenetic analysis:

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian approaches

    • Include outgroups from non-teleost vertebrates

    • Test different evolutionary models and select the best fit

    • Evaluate node support using bootstrap or posterior probabilities

  • Synteny analysis:

    • Examine conservation of genomic neighborhoods

    • Identify potential gene duplications or losses

    • Use tools like Genomicus or SynFind for visualization

  • Protein structure prediction and comparison:

    • Generate 3D models using AlphaFold2 or RoseTTAFold

    • Compare predicted structures to identify conserved features

    • Analyze substrate binding pockets for functional divergence

    • Identify potential selectivity-determining residues

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under purifying or positive selection

    • Perform branch-site tests to identify lineage-specific selection

    • Use tools like PAML, HyPhy, or MEME for selection analysis

  • Expression data integration:

    • Compile available RNA-seq data across species

    • Compare tissue-specific expression patterns

    • Analyze promoter regions for conserved regulatory elements

Research indicates that HSD17B3 and HSD17B12 are descendants from a common ancestor , making evolutionary analysis particularly informative for understanding functional divergence in this gene family.

How should researchers address potential contradictions between in vitro and in vivo functional data for hsd17b12b?

When faced with contradictions between in vitro and in vivo functional data for hsd17b12b, researchers should systematically investigate potential sources of discrepancy using the following approach:

  • Evaluate experimental context differences:

    • Substrate availability and concentration differences

    • Presence/absence of cofactors and regulatory proteins

    • pH, temperature, and ionic conditions

    • Cellular compartmentalization effects

  • Consider protein modifications and interactions:

    • Post-translational modifications present in vivo but absent in vitro

    • Interaction with membrane lipids affecting enzyme function

    • Protein-protein interactions modulating activity

    • Potential formation of multi-enzyme complexes

  • Assess methodological limitations:

    • Sensitivity and specificity of activity assays

    • Detection limits for products and intermediates

    • Potential artifacts in protein preparation

    • Temporal dynamics not captured in endpoint assays

  • Design reconciliation experiments:

    • Cell-free systems with native membrane fractions

    • Organelle isolation to bridge in vitro/in vivo gap

    • Genetic complementation with mutant variants

    • Structure-function studies targeting specific domains

  • Interpret results in broader biological context:

    • Consider metabolic flux rather than single reactions

    • Evaluate redundancy and compensatory mechanisms

    • Assess tissue-specific effects and developmental timing

    • Integrate with similar data from related enzymes

Creating a comprehensive experimental matrix that systematically varies conditions between in vitro and in vivo settings can help identify the specific factors responsible for observed discrepancies.

What are the common pitfalls in metabolomic analysis of hsd17b12b function in lipid metabolism?

Metabolomic analysis of hsd17b12b function in lipid metabolism presents several challenges that researchers should be aware of:

  • Sample preparation challenges:

    • Rapid changes in lipid metabolism post-mortem

    • Oxidation of polyunsaturated fatty acids during processing

    • Incomplete extraction of membrane-bound lipids

    • Developmental stage-specific metabolite profiles

  • Analytical considerations:

    • Ionization suppression in complex lipid mixtures

    • Isomer differentiation challenges (especially for fatty acids)

    • Dynamic range limitations for abundant vs. trace lipids

    • Quantification accuracy for structurally diverse lipids

  • Data interpretation pitfalls:

    • Misattribution of direct vs. indirect metabolic effects

    • Over-interpretation of changes in single metabolites

    • Failure to consider alternative metabolic pathways

    • Inadequate statistical power for detecting subtle changes

  • Biological complexity factors:

    • Compensatory upregulation of alternative pathways

    • Tissue-specific metabolism differences

    • Maternal contribution in early developmental stages

    • Influence of environmental factors (temperature, diet)

  • Recommended solutions:

    • Use stable isotope-labeled tracers to track metabolic flux

    • Employ multiple extraction methods to capture diverse lipid classes

    • Include appropriate internal standards for each lipid class

    • Perform pathway enrichment analysis rather than focusing on individual metabolites

    • Compare results between multiple timepoints and tissues

Studies of hsd17b12a demonstrate the importance of analyzing the complete lipid pathway, as defects in this enzyme affect not only direct substrates and products but also downstream lipid-dependent processes like the DHA-PA-PG axis .

How can researchers differentiate between hsd17b12b effects on steroid metabolism versus fatty acid biosynthesis?

Differentiating between the dual functions of hsd17b12b in steroid metabolism and fatty acid biosynthesis requires a multi-faceted experimental approach:

  • Substrate-specific activity assays:

    • Parallel assays with steroid and fatty acid substrates

    • Competition assays to determine substrate preference

    • Kinetic parameters (Km, Vmax) for each substrate class

    • Inhibitor studies with pathway-specific inhibitors

  • Domain-focused mutagenesis:

    • Structure-guided mutations targeting substrate binding regions

    • Creation of chimeric proteins with related enzymes

    • Identification of residues determining substrate specificity

    • Testing mutants in both steroid and fatty acid assays

  • Metabolic labeling experiments:

    • Dual-label experiments with isotope-labeled precursors for both pathways

    • Pulse-chase experiments to track metabolic flux

    • Tissue-specific analysis of label incorporation

    • Comparison of wildtype and mutant metabolic profiles

  • Temporal and spatial resolution approaches:

    • Developmental time-course analysis

    • Tissue-specific expression manipulation

    • Cell type-specific knockout or knockdown

    • Subcellular localization studies

  • Comprehensive data integration:

    • Correlation analysis between steroid and fatty acid metabolites

    • Pathway reconstruction with flux balance analysis

    • Integration with transcriptomic data for compensatory responses

    • Phenotypic correlation with pathway-specific markers

The study of human HSD17B12 suggests investigating the enzyme's very-long-chain fatty acid metabolic capacity as a potential primary function , while still considering its role in steroid metabolism based on its classification in the hydroxysteroid dehydrogenase family .

What are the promising approaches for studying the role of hsd17b12b in zebrafish development?

Several innovative approaches show promise for elucidating the role of hsd17b12b in zebrafish development:

  • Single-cell transcriptomics and spatial profiling:

    • scRNA-seq to identify cell populations expressing hsd17b12b

    • Spatial transcriptomics to map expression patterns with tissue context

    • Cell lineage tracing to determine developmental origins of expressing cells

    • Integration with other omics data for functional networks

  • Advanced genetic manipulation techniques:

    • Tissue-specific and inducible CRISPR systems

    • Base editing for introducing specific mutations

    • Prime editing for precise sequence modifications

    • Optogenetic control of gene expression

  • Live imaging approaches:

    • Fluorescent reporter fusion proteins to track localization

    • FRET-based activity sensors for real-time enzyme monitoring

    • Light-sheet microscopy for whole-embryo imaging

    • Correlation with metabolite distributions using imaging mass spectrometry

  • Integrative multi-omics:

    • Combined transcriptomics, proteomics, and metabolomics

    • Time-resolved analysis across developmental stages

    • Network analysis to identify regulatory interactions

    • Comparison with orthologous systems in other model organisms

  • Physiological and behavioral phenotyping:

    • Comprehensive assessment of digestive organ development

    • Analysis of lipid absorption and utilization

    • Effect on stress responses and adaptive behaviors

    • Long-term developmental consequences

Research on hsd17b12a suggests focusing on the role of hsd17b12b in digestive organ development, lipid metabolism pathways, and potential interactions with the intestinal DHA-PA-PG axis .

How might hsd17b12b be involved in disease models in zebrafish?

Based on current knowledge of hsd17b12b and its human ortholog, several disease models could be explored in zebrafish:

  • Lipid metabolism disorders:

    • Models for very-long-chain fatty acid synthesis defects

    • Investigation of essential fatty acid deficiency

    • Analysis of membrane lipid composition abnormalities

    • Connection to fatty liver disease models

  • Developmental disorders:

    • Focus on digestive organ development

    • Investigation of endocrine system development

    • Analysis of potential neural development roles

    • Connection to congenital defects involving affected tissues

  • Viral infection models:

    • Exploration of role in flavivirus replication similar to human ortholog

    • Development of zebrafish infection models

    • Gene knockout/knockdown effects on viral susceptibility

    • Mechanistic studies of lipid-dependent viral replication

  • Cancer models:

    • Investigation of role in cell proliferation and migration

    • Analysis of lipid metabolism reprogramming in cancer

    • Connection to steroid-dependent cancer models

    • Potential therapeutic targeting approaches

  • Methodological considerations for disease modeling:

    • Use of transparent casper mutants for in vivo imaging

    • Combinatorial genetic approaches with disease-associated genes

    • High-throughput chemical screening for modulators

    • Age-dependent phenotypic analysis

The identification of human HSD17B12 as a host co-factor involved in the replication of HCV and related flaviviruses suggests potential roles for zebrafish hsd17b12b in viral pathogenesis models .

What novel insights might be gained from comparative analysis of hsd17b12b across model organisms?

Comparative analysis of hsd17b12b across model organisms could yield several novel insights:

  • Evolutionary aspects of enzyme function:

    • Substrate specificity shifts across vertebrate evolution

    • Correlation between enzyme evolution and lipid composition

    • Identification of conserved vs. species-specific functions

    • Relationship between gene duplication and functional divergence

  • Developmental role conservation:

    • Comparison of knockout phenotypes across model organisms

    • Analysis of temporal expression patterns during development

    • Conservation of tissue-specific expression profiles

    • Identification of species-specific developmental requirements

  • Regulatory mechanisms:

    • Promoter analysis across species to identify conserved elements

    • miRNA targeting patterns and conservation

    • Epigenetic regulation in different model systems

    • Response to environmental and metabolic signals

  • Disease relevance:

    • Cross-species validation of disease mechanisms

    • Identification of compensatory mechanisms in different species

    • Prediction of human disease variants based on model organism data

    • Development of translational research strategies

  • Recommended methodological approaches:

    • Systematic CRISPR knockout across model systems

    • Standardized phenotyping platforms for cross-species comparison

    • Heterologous expression of orthologs in common cellular backgrounds

    • Mathematical modeling of metabolic networks across species

The phylogenetic relationship between HSD17B3 and HSD17B12 as descendants from a common ancestor suggests that comparative analysis across species could reveal important insights into the functional evolution of this enzyme family.

What structural features of hsd17b12b are important for substrate recognition and catalysis?

Based on structural analysis and comparison with related enzymes, several key features of hsd17b12b are likely important for substrate recognition and catalysis:

  • Conserved NAD(P)-binding domain:

    • Rossmann fold with characteristic glycine-rich motif (GxxxGxG)

    • Specific interactions with the nicotinamide and adenine portions of the cofactor

    • Determining cofactor preference (NADPH vs. NADH)

    • Positioning the reactive part of the cofactor relative to substrate

  • Substrate binding pocket characteristics:

    • Hydrophobic tunnel for fatty acid chain accommodation

    • Specific recognition elements for steroid substrate positioning

    • Size and shape constraints determining substrate chain length specificity

    • Residues forming hydrogen bonds with substrate functional groups

  • Catalytic residues:

    • Catalytic triad typically including Ser, Tyr, and Lys residues

    • Proton relay system for stereospecific hydride transfer

    • Positioning of substrate relative to nicotinamide ring of cofactor

    • Residues stabilizing reaction transition state

  • Membrane interaction regions:

    • Amphipathic helices for membrane association

    • Potential substrate access channels from the membrane

    • Regulatory regions modulating membrane interaction

    • Interface with other membrane proteins in potential complexes

  • Structural elements determining specificity:

    • Loops connecting core secondary structure elements

    • C-terminal region influencing substrate access

    • Dimerization interface affecting active site configuration

    • Conformational changes upon cofactor binding

Domain analysis indicates hsd17b12b contains the short-chain dehydrogenase/reductase (SDR) family domain, which typically features a conserved catalytic tetrad and specific cofactor-binding motifs .

How do post-translational modifications potentially affect hsd17b12b function?

Post-translational modifications (PTMs) may significantly impact hsd17b12b function through various mechanisms:

  • Phosphorylation:

    • Potential modification of serine, threonine, and tyrosine residues

    • Regulation of enzyme activity through conformational changes

    • Modulation of protein-protein interactions

    • Potential developmental stage-specific regulation

  • Glycosylation:

    • N-linked glycosylation at consensus sequons (Asn-X-Ser/Thr)

    • Influence on protein folding and stability

    • Potential impact on membrane localization

    • Protection from proteolytic degradation

  • Lipid modifications:

    • Palmitoylation of cysteine residues

    • Enhancement of membrane association

    • Targeting to specific membrane microdomains

    • Regulation of protein-protein interactions

  • Other potential modifications:

    • Ubiquitination affecting protein turnover

    • SUMOylation influencing protein localization

    • Acetylation affecting enzyme activity

    • Proteolytic processing of regulatory domains

  • Experimental approaches to investigate PTMs:

    • Mass spectrometry-based proteomic analysis

    • Site-directed mutagenesis of predicted modification sites

    • Pharmacological inhibition of specific modification enzymes

    • Comparison of modifications across developmental stages

Based on phosphoproteomics data from related studies, researchers should particularly investigate potential regulatory phosphorylation sites that might coordinate enzyme activity with developmental processes or metabolic status .

What is the current understanding of hsd17b12b protein-protein interactions in metabolic pathways?

The current understanding of hsd17b12b protein-protein interactions in metabolic pathways remains limited, but several potential interactions can be inferred from related enzymes:

  • Fatty acid elongation complex components:

    • Likely interactions with elongation of very long chain fatty acids protein (ELOVL)

    • Potential complex formation with 3-ketoacyl-CoA reductase

    • Interaction with trans-2,3-enoyl-CoA reductase

    • Coordination with acyl-CoA synthetases for substrate channeling

  • Steroid metabolism pathway partners:

    • Possible interactions with other hydroxysteroid dehydrogenases

    • Relationship with cytochrome P450 enzymes in steroid biosynthesis

    • Connections to steroid receptors and transport proteins

    • Potential feedback regulation through protein-protein interactions

  • Membrane-associated interactors:

    • Interactions with endoplasmic reticulum organization proteins

    • Association with lipid raft components

    • Potential interactions with lipid transfer proteins

    • Connections to membrane fusion and vesicle transport machinery

  • Regulatory partners:

    • Interactions with kinases and phosphatases

    • Association with ubiquitin-proteasome system components

    • Potential scaffolding protein interactions

    • Developmental regulators specific to expression tissues

  • Recommended experimental approaches:

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening with membrane adaptations

    • Split-protein complementation assays in zebrafish cells

Analysis of proteins that show significantly increased peptide abundances in experimental contexts could provide clues to potential interaction networks involving hsd17b12b and related proteins .

What are the latest technological advances for studying hsd17b12b function in zebrafish?

Recent technological advances offer new opportunities for studying hsd17b12b function in zebrafish:

  • Advanced genome editing technologies:

    • Prime editing for precise nucleotide changes

    • Base editing for targeted C→T or A→G conversions

    • CRISPR interference/activation for reversible gene regulation

    • Tissue-specific and inducible CRISPR systems

  • Advanced imaging techniques:

    • Lattice light-sheet microscopy for high-resolution live imaging

    • Expansion microscopy for subcellular resolution

    • Super-resolution microscopy (STORM, PALM) for protein localization

    • Correlative light and electron microscopy for ultrastructural context

  • Single-cell and spatial technologies:

    • Single-cell RNA-seq for cell-type specific expression

    • Spatial transcriptomics for tissue context

    • CyTOF for single-cell protein analysis

    • Slide-seq for spatial resolution of gene expression

  • Metabolomic advances:

    • REIMS (Rapid Evaporative Ionization Mass Spectrometry) for real-time analysis

    • Imaging mass spectrometry for spatial metabolomics

    • Ion mobility-mass spectrometry for improved isomer separation

    • Stable isotope-resolved metabolomics for flux analysis

  • High-throughput phenotyping platforms:

    • Automated behavioral analysis systems

    • High-content imaging for morphological phenotyping

    • Microfluidic systems for embryo manipulation

    • ZebraBox systems for continuous monitoring

These technological advances can be particularly valuable for investigating the DHA-PA-PG axis, which has been implicated in the function of related enzymes like hsd17b12a in zebrafish development .

How can researchers develop zebrafish-specific antibodies for hsd17b12b detection?

Developing zebrafish-specific antibodies for hsd17b12b detection requires a systematic approach:

  • Antigen design strategies:

    • Identification of unique, surface-exposed epitopes specific to zebrafish hsd17b12b

    • Selection of regions with low homology to hsd17b12a to ensure specificity

    • Multiple peptide synthesis spanning different regions

    • Production of recombinant protein fragments for immunization

  • Immunization approaches:

    • Mouse monoclonal antibody development

    • Rabbit polyclonal antibody production

    • Chicken IgY antibodies for increased evolutionary distance

    • Llama nanobodies for recognizing conformational epitopes

  • Screening and validation methods:

    • ELISA screening against recombinant protein

    • Western blot validation with tissue lysates

    • Immunoprecipitation to confirm specificity

    • Immunohistochemistry with proper controls including knockout tissue

    • Cross-reactivity testing against hsd17b12a and related proteins

  • Optimization for different applications:

    • Fixation compatibility testing for immunohistochemistry

    • Buffer optimization for Western blotting

    • Epitope retrieval methods for paraffin sections

    • Determination of optimal antibody concentration for each application

  • Alternative approaches if antibody development fails:

    • Epitope tagging of endogenous protein using CRISPR knock-in

    • Development of nanobodies or aptamers

    • Protein detection using targeted mass spectrometry

    • Fluorescent protein fusion for live imaging

Researchers should note that the validation of antibodies for zebrafish proteins can be challenging due to potential cross-reactivity with paralogs (like hsd17b12a) and other related proteins in the short-chain dehydrogenase/reductase family .

What high-throughput screening approaches can be used to identify modulators of hsd17b12b activity?

Several high-throughput screening approaches can be employed to identify modulators of hsd17b12b activity:

  • In vitro enzyme activity screens:

    • Fluorescence-based assays monitoring NADPH consumption

    • Coupled enzyme assays for product detection

    • Thermal shift assays to identify stabilizing ligands

    • Surface plasmon resonance for binding kinetics

  • Cell-based reporter systems:

    • Zebrafish cell lines with fluorescent reporters linked to hsd17b12b activity

    • FRET-based biosensors for enzyme activity

    • Bioluminescence resonance energy transfer (BRET) assays

    • Transcriptional reporters responsive to pathway products

  • In vivo zebrafish screening platforms:

    • Transgenic lines with fluorescent reporters in hsd17b12b-expressing tissues

    • Automated morphological phenotyping of embryos

    • Behavioral analysis for phenotypes related to steroid hormone function

    • Metabolic imaging using fluorescent lipid analogs

  • Computational and virtual screening approaches:

    • Structure-based virtual screening using homology models

    • Pharmacophore modeling based on known substrates and inhibitors

    • Quantitative structure-activity relationship (QSAR) modeling

    • Machine learning approaches integrating multiple data types

  • Target identification and validation strategies:

    • Affinity-based target identification for hit compounds

    • CRISPR-Cas9 mutagenesis of predicted binding sites

    • Thermal proteome profiling to confirm target engagement

    • Metabolomic profiling to confirm pathway modulation

The role of human HSD17B12 in viral replication suggests that screening approaches might also focus on compounds that could modulate this function, potentially identifying novel antiviral strategies .

What are the recommended databases and bioinformatic resources for hsd17b12b research?

Researchers studying zebrafish hsd17b12b should utilize the following databases and bioinformatic resources:

  • Zebrafish-specific databases:

    • ZFIN (Zebrafish Information Network) - comprehensive gene information

    • Ensembl Zebrafish - genome browser and annotation

    • ZIRC (Zebrafish International Resource Center) - mutant and transgenic lines

    • ZebrafishMine - integrated data mining platform

  • Sequence and structure databases:

    • UniProt - protein sequence and functional information

    • NCBI GenBank - nucleotide sequences

    • PDB (Protein Data Bank) - experimental protein structures

    • AlphaFold DB - predicted protein structures

  • Comparative genomics resources:

    • Genomicus - synteny analysis across species

    • Ensembl Compara - gene trees and orthology relationships

    • OrthoDB - hierarchical catalog of orthologs

    • PANTHER - protein evolution and classification

  • Functional annotation databases:

    • GO (Gene Ontology) - functional annotation

    • KEGG - pathway mapping

    • Reactome - curated pathway database

    • STRING - protein-protein interaction networks

  • Expression and phenotype databases:

    • Expression Atlas - gene expression across tissues

    • GXD (Gene Expression Database) - developmental expression patterns

    • PhenomicDB - phenotype data integration

    • 4DN Data Portal - chromatin organization data

  • Specialized tools:

    • CRISPRscan - guide RNA design for zebrafish

    • CHOPCHOP - CRISPR/Cas9 target prediction

    • Primer3Plus - PCR primer design

    • MFold - RNA secondary structure prediction

ZFIN provides comprehensive information about hsd17b12b, including its genomic location, expression patterns, and protein domains , making it an essential starting point for researchers.

How can researchers use transcriptomic datasets to understand the regulatory network of hsd17b12b?

Leveraging transcriptomic datasets to understand the regulatory network of hsd17b12b involves several strategic approaches:

  • Co-expression network analysis:

    • Weighted Gene Co-expression Network Analysis (WGCNA)

    • Identification of gene modules correlated with hsd17b12b expression

    • Construction of developmental stage-specific co-expression networks

    • Integration with protein-protein interaction data

  • Differential expression analysis across conditions:

    • Comparison across developmental timepoints

    • Analysis of tissue-specific expression patterns

    • Response to environmental or pharmacological perturbations

    • Comparison between wildtype and mutant/morphant models

  • Regulatory element identification:

    • Motif enrichment analysis in promoter regions of co-expressed genes

    • Integration with ChIP-seq datasets for transcription factor binding

    • ATAC-seq analysis for chromatin accessibility

    • Enhancer prediction using epigenomic marks

  • Pathway and functional enrichment analysis:

    • Gene Ontology enrichment of co-expressed genes

    • Pathway analysis using KEGG, Reactome, or WikiPathways

    • Metabolic pathway enrichment focusing on lipid metabolism

    • Comparison with steroid hormone response signatures

  • Integration of multi-omics data:

    • Correlation with proteomics datasets

    • Integration with metabolomics for functional validation

    • Incorporation of epigenomic data to identify regulatory mechanisms

    • Single-cell RNA-seq for cell type-specific regulatory networks

  • Recommended analytical workflows:

    • Use R packages like DESeq2 or edgeR for differential expression

    • Employ Cytoscape for network visualization and analysis

    • Utilize GSEA for pathway enrichment analysis

    • Apply machine learning approaches for regulatory network inference

Analysis of statistically significant proteins identified by statistical tests such as Student's t-test can provide valuable insights into the regulatory networks involving hsd17b12b and related proteins .

What computational modeling approaches can predict substrate specificity of hsd17b12b?

Computational modeling approaches for predicting substrate specificity of hsd17b12b include:

  • Homology modeling and structure prediction:

    • Construction of 3D models based on crystal structures of related enzymes

    • Refinement using molecular dynamics simulations

    • Validation through energy minimization and Ramachandran plots

    • Integration of AlphaFold2 predictions with experimental data

  • Molecular docking simulations:

    • Rigid and flexible docking of potential substrates

    • Ensemble docking using multiple protein conformations

    • Evaluation of binding energies and interaction patterns

    • Comparison of docking poses for different substrate classes

  • Molecular dynamics simulations:

    • Substrate binding stability analysis

    • Water and cofactor interactions in the active site

    • Conformational changes upon substrate binding

    • Free energy calculations for different substrates

  • Quantum mechanics/molecular mechanics (QM/MM) approaches:

    • Detailed modeling of reaction mechanisms

    • Transition state energy calculations

    • Stereospecificity prediction

    • Reaction coordinate profiling

  • Machine learning-based predictions:

    • Development of QSAR models for substrate specificity

    • Neural network prediction of enzyme-substrate compatibility

    • Integration of sequence and structural features

    • Transfer learning from related enzymes with known specificity

  • Validation strategies:

    • In vitro testing of computationally predicted substrates

    • Site-directed mutagenesis of predicted specificity-determining residues

    • Comparison with experimental binding and kinetic data

    • Cross-validation with orthologous enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.