Recombinant Danio rerio Fat storage-inducing transmembrane protein 1 (fitm1)

Shipped with Ice Packs
In Stock

Description

  • The protein’s functionality is validated via lipid-binding assays and lipid droplet formation tests in HEK293 cells .

  • Repeated freeze-thaw cycles are discouraged to maintain stability .

Role in Lipid Metabolism

FITM1 binds directly to triglycerides (TAG) and diacylglycerol (DAG), facilitating lipid droplet biogenesis . Studies show:

  • Binding Specificity: FITM1 exhibits higher affinity for TAG than DAG, with a dissociation constant (Kd) of ~100–250 nM .

  • Lipid Droplet Size: Overexpression in HEK293 cells produces smaller lipid droplets compared to FITM2, which generates larger droplets .

Regulatory Mechanisms

  • Transcriptional Control: FITM1 expression in zebrafish and mammals is regulated by muscle development factors like MyoD1 and energy sensors like PGC-1α .

  • Chemical Modulation: Exposure to compounds like bisphenol A or doxorubicin downregulates FITM1 expression, while ligands such as pirinixic acid upregulate it .

Applications in Research

ApplicationExperimental ModelKey Findings
Lipid Metabolism StudiesZebrafish embryosFITM1 knockdown reduces lipid storage capacity in muscle tissue .
Toxicology ScreeningRat hepatocytesFITM1 expression changes correlate with liver toxicity from phthalates .
Structural BiologyIn vitro binding assaysFITM1’s TAG-binding domain is critical for lipid droplet nucleation .

Comparative Analysis with Orthologues

FeatureZebrafish FITM1Human FITM1Mouse FITM2
Tissue ExpressionSkeletal muscle, heartSkeletal muscle, heartAdipose tissue, liver
Lipid Droplet PhenotypeSmall dropletsSmall dropletsLarge droplets
Regulatory FactorsMyoD1, PPARαPGC-1α, PPARγZfp69, PPARα

Challenges and Future Directions

  • Structural Resolution: No crystal structure exists for FITM1, limiting mechanistic insights .

  • In Vivo Models: Zebrafish mutants with fitm1 knockouts are needed to study developmental lipid metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it based on your requirements.
Synonyms
fitm1l; fit1; fitm1; zgc:112967; Fat storage-inducing transmembrane protein 1; FITM1-like protein; Fat-inducing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
fitm1
Target Protein Sequence
MFLNSILVVITDLAAGLLGNTSFRRHFHLLLSALLLFGPLLSLWVSHYSVFAKRTHFLYR VFLRSGWGWTCIFVGSFVFVLSFSVRRSLTLSLRHLSRLAVAGGLWLGFRKLLCLLENAT GSCYEPLSAALEMTSGTNGEGQPLLLLREAETKETCVRSGMLWRGYEVSEDALLLCLCCL LLAEETAVFGPYLNLGGPSEAPLRILFLFCVLLLSLWVFLLLCLLAYFPEFPTQLLGGAL GCLSWRALYQGWYRLRPSWYCPGRPGVGLLSTQSKQDELLETQTNAKEID
Uniprot No.

Target Background

Function
FAT STORAGE-INDUCING TRANSMEMBRANE PROTEIN 1 (FITM1) may play a crucial role in the formation of lipid droplets (LDs), which serve as storage organelles central to lipid and energy homeostasis. FITM1 may directly bind to diacylglycerol (DAGs) and triacylglycerol.
Database Links
Protein Families
FIT family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Fat Storage-Inducing Transmembrane Protein 1 (fitm1) and what is its function in zebrafish?

Fat Storage-Inducing Transmembrane Protein 1 (fitm1) belongs to an evolutionarily conserved family of proteins involved in fat storage. In zebrafish and other organisms, fitm1 is an endoplasmic reticulum (ER) resident transmembrane protein that plays a crucial role in lipid droplet (LD) formation. Unlike triglyceride-synthesizing enzymes such as diacylglycerol O-acyltransferases, fitm1 does not synthesize triglycerides but rather partitions them into lipid droplets through direct binding mechanisms . The FITM family was first identified in 2007 and has since been recognized as a key component in cellular lipid handling across numerous species, including zebrafish which has a confirmed FITM1 homolog .

How does zebrafish fitm1 expression compare to its mammalian counterparts?

Zebrafish fitm1 shares considerable homology with mammalian FITM1, though with distinct expression patterns. In mammals, FITM1 is primarily expressed in heart and skeletal muscle, with lower levels in liver, kidney, and testes . Protein expression studies confirm that mammalian FITM1 is predominantly found in skeletal muscle with lower expression in cardiac tissue . While comprehensive expression mapping in zebrafish is still evolving, researchers should note that the tissue-specific expression of fitm1 in zebrafish may differ from mammalian models, potentially affecting experimental design and data interpretation. When working with recombinant zebrafish fitm1, consideration of these expression differences becomes crucial for translational research .

What methods are optimal for studying fitm1 function in zebrafish models?

For investigating fitm1 function in zebrafish, researchers should consider a multi-method approach:

  • Morpholino-based knockdown: Temporary suppression of fitm1 translation can be achieved using antisense morpholino oligonucleotides injected at the 1-4 cell stage.

  • CRISPR/Cas9 gene editing: For permanent genetic modification, CRISPR-based approaches can generate zebrafish lines with specific fitm1 mutations.

  • Transgenic overexpression: Creating zebrafish lines with tissue-specific promoters driving fitm1 expression allows for gain-of-function studies.

  • In vivo lipid analysis: The transparency of zebrafish embryos permits direct visualization of lipid droplets using lipophilic dyes such as Nile Red or BODIPY .

  • High-content screening (HCS): Zebrafish embryos can be used for high-resolution analysis of drug effects on fitm1 function and lipid metabolism in a whole vertebrate context .

The zebrafish model's advantages of external development, transparency, and rapid growth make it particularly suitable for these methodological approaches .

How does recombinant zebrafish fitm1 bind to triglycerides and what are the binding kinetics?

Recombinant zebrafish fitm1, like its mammalian counterparts, demonstrates direct binding to triglycerides with specific saturation-binding kinetics. The binding process involves purification of the protein in detergent micelles, which maintains the proper conformation for triglyceride interaction . Research indicates that recombinant fitm1 has lower binding affinity for triolein compared to FITM2, which correlates with functional differences in lipid droplet formation capacity .

When studying this binding interaction, researchers should implement the following methodology:

  • Express recombinant zebrafish fitm1 with appropriate tags (His, Avi, or Fc) in systems such as E. coli or mammalian cells (e.g., HEK293)

  • Purify the protein while maintaining native conformation

  • Conduct binding assays using radiolabeled or fluorescently labeled triglycerides

  • Analyze binding data using Scatchard plots or similar approaches to determine Kd values and binding stoichiometry

The binding affinity and specificity of fitm1 for different lipid species may provide insights into its evolutionary role in zebrafish lipid metabolism compared to mammals.

What signaling pathways regulate fitm1 expression in zebrafish, and how can these be experimentally manipulated?

The regulation of fitm1 expression in zebrafish involves multiple signaling pathways, similar to those in mammalian systems but with potential species-specific variations. In mammals, FITM1 transcription is promoted by MyoD1 binding to E-box elements in the core promoter region during muscle differentiation . PGC-1α (peroxisome proliferator-activated receptor-gamma coactivator 1 alpha) also stimulates FITM1 expression in skeletal muscle cells .

To experimentally investigate these pathways in zebrafish, researchers can employ:

  • Promoter analysis: Cloning the zebrafish fitm1 promoter region and conducting deletion/mutation studies to identify regulatory elements

  • ChIP assays: Determining transcription factor binding to the fitm1 promoter in vivo

  • Small molecule modulators: Using activators or inhibitors of specific pathways (e.g., PPARα agonists) to assess effects on fitm1 expression

  • Environmental manipulations: As research shows that factors like light exposure can affect FITM2 expression in zebrafish larvae , similar approaches may reveal environmental regulators of fitm1

Understanding these regulatory mechanisms provides insights into how fitm1 expression responds to metabolic challenges and developmental cues in zebrafish.

How can recombinant Danio rerio fitm1 be utilized in high-throughput screening for modulators of lipid metabolism?

Zebrafish embryos provide an excellent platform for high-throughput screening (HTS) of compounds that may modulate fitm1 function and lipid metabolism . Recombinant fitm1 can be leveraged in these screens through several approaches:

  • In vitro binding assays: Using purified recombinant fitm1 to screen for compounds that alter its triglyceride-binding capabilities

  • Cell-based assays: Employing zebrafish cell lines expressing recombinant fitm1 to assess effects on lipid droplet formation

  • Whole-organism screens: Utilizing transgenic zebrafish expressing fluorescently tagged fitm1 to visualize protein localization and function in response to compound libraries

The high-content screening (HCS) methodology is particularly powerful as it allows analysis at high resolution of drug effects on whole vertebrates, revealing whole-body effects as well as those on specific organs and tissues . This approach can identify compounds that specifically target fitm1-mediated lipid storage without affecting other aspects of lipid metabolism.

What expression systems are most effective for producing functional recombinant zebrafish fitm1?

The production of functional recombinant zebrafish fitm1 requires careful consideration of expression systems to maintain proper protein folding and activity. Based on available data, researchers have successfully used:

  • E. coli expression systems: While cost-effective and high-yielding, bacterial systems may require optimization to ensure proper folding of this transmembrane protein

  • Mammalian cell expression: HEK293 cells have been successfully employed for expressing functional FITM proteins, allowing proper folding and post-translational modifications

  • Insect cell systems: Baculovirus-infected insect cells can provide a compromise between yield and proper eukaryotic processing

When expressing recombinant fitm1, the addition of affinity tags such as His, Avi, or Fc can facilitate purification while minimally impacting function . The choice of expression system should be guided by the intended application, with mammalian systems generally preferred for functional studies due to their ability to properly fold membrane proteins.

What are the optimal methods for assessing recombinant zebrafish fitm1 functionality in lipid droplet formation?

Assessing the functionality of recombinant zebrafish fitm1 in lipid droplet formation requires a combination of cellular and biochemical approaches:

  • Cell-based lipid droplet assays: Transfect cells (e.g., HEK293) with recombinant fitm1 constructs and quantify lipid droplet formation using fluorescent lipid dyes like BODIPY or Oil Red O

  • Triglyceride partitioning assays: Measure the ability of recombinant fitm1 to facilitate triglyceride incorporation into isolated microsomes

  • Binding specificity assays: Determine the lipid-binding profile of recombinant fitm1 using a panel of different lipid species

When conducting these assays, it's important to include appropriate controls such as known functional mutations (e.g., the FLL(157-9)AAA gain-of-function or N80A partial loss-of-function equivalents in zebrafish fitm1) to validate assay performance .

How can researchers distinguish between the functions of fitm1 and fitm2 in zebrafish models?

Distinguishing between fitm1 and fitm2 functions in zebrafish requires careful experimental design:

  • Tissue-specific expression analysis: In mammals, FITM1 is primarily expressed in skeletal muscle, while FITM2 is more ubiquitous with highest expression in adipose tissue . Similar expression mapping in zebrafish can help distinguish their roles.

  • Selective gene knockdown/knockout: Using targeted approaches to individually modulate fitm1 and fitm2 expression:

    • Morpholino knockdown

    • CRISPR/Cas9 gene editing

    • Selective RNA interference

  • Rescue experiments: Cross-complementation studies where fitm1 is expressed in fitm2-deficient models and vice versa can reveal functional redundancy or specificity.

  • Biochemical differentiation:

    PropertyFITM1FITM2Experimental Method
    Triglyceride binding affinityLowerHigherRadiolabeled binding assays
    Lipid droplet size influenceSmaller LDsLarger LDsMicroscopic quantification
    Tissue distributionPrimarily muscleMore ubiquitousqPCR, immunohistochemistry

This multifaceted approach can reveal the distinct and overlapping functions of these related proteins in zebrafish lipid metabolism.

How can recombinant zebrafish fitm1 be utilized to investigate evolutionary conservation of lipid storage mechanisms?

Investigating evolutionary conservation of lipid storage mechanisms using recombinant zebrafish fitm1 can be approached through:

  • Comparative structural analysis: Align protein sequences and predicted structures of fitm1 proteins across species to identify conserved domains and motifs

  • Cross-species functional complementation: Express zebrafish fitm1 in FITM1-deficient mammalian cells or yeast to assess functional conservation

  • Binding studies with diverse lipid species: Compare lipid-binding profiles of recombinant fitm1 proteins from different species

The FITM family is evolutionarily conserved across eukaryotes, but sequences of FITM family orthologs in non-vertebrates exhibit lower homology than those of vertebrates . This makes zebrafish an important intermediate model for understanding evolutionary adaptations in lipid storage mechanisms.

What role does fitm1 play in zebrafish muscle development and how can recombinant protein studies illuminate this function?

FITM1's role in zebrafish muscle development can be investigated using recombinant protein approaches through:

  • Myogenesis models: In mammals, MyoD1 promotes FITM1 transcription by binding to E-box elements in the core promoter region during muscle cell differentiation . Similar mechanisms likely exist in zebrafish and can be studied using recombinant fitm1 and DNA-protein interaction assays.

  • Contractile tissue-specific expression: The predominant expression of FITM1 in skeletal muscle in mammals suggests specialized functions in this tissue . Researchers can investigate whether recombinant zebrafish fitm1 interacts with muscle-specific proteins using co-immunoprecipitation studies.

  • Energy metabolism in muscle: PGC-1α stimulates FITM1 expression in human skeletal muscle cells and enhances the formation of smaller lipid droplets with modest increases in triacylglycerol content . This suggests fitm1 may play a role in muscle energy homeostasis in zebrafish, which can be explored using metabolic flux analyses in the presence of recombinant fitm1.

Understanding these mechanisms provides insights into how fitm1 contributes to muscle development and function in zebrafish, with potential implications for human muscle physiology and pathology.

What are common challenges in producing and purifying functional recombinant zebrafish fitm1 protein?

Producing and purifying functional recombinant zebrafish fitm1 presents several challenges due to its transmembrane nature:

  • Protein solubility issues: As an integral membrane protein, fitm1 requires detergent micelles or membrane mimetics for proper solubilization and maintenance of native structure .

  • Expression system selection: Bacterial systems may yield inclusion bodies requiring refolding, while mammalian systems may have lower yields but better folding .

  • Maintaining triglyceride binding activity: The purification process must preserve the protein's ability to bind lipids, which can be compromised by harsh detergents.

To address these challenges, researchers should:

  • Screen multiple detergents (mild non-ionic detergents like DDM often work well)

  • Consider membrane-mimetic systems like nanodiscs or amphipols

  • Include stabilizing agents such as glycerol in purification buffers

  • Validate protein functionality through triglyceride binding assays after purification

  • Consider fusion partners that enhance solubility while minimally impacting function

How can researchers optimize zebrafish models to study fitm1 function in vivo?

Optimizing zebrafish models for studying fitm1 function requires consideration of several factors:

  • Genetic background selection: Different wild-type zebrafish strains may have variations in lipid metabolism that affect fitm1 function studies. Researchers should characterize baseline lipid metabolism in their chosen strain.

  • Developmental timing: Since zebrafish undergo rapid development , the timing of fitm1 manipulation or analysis is critical. A developmental expression profile of fitm1 should guide experimental timing.

  • Diet standardization: Dietary fatty acid composition can significantly impact lipid droplet formation and fitm1 function. Standardized diets should be used to reduce experimental variability.

  • Environmental conditions: Factors such as light exposure have been shown to affect FITM family gene expression in zebrafish larvae . Standardized housing conditions are essential for reproducible results.

  • Visualization techniques: The transparency of zebrafish embryos enables powerful in vivo imaging . Researchers should optimize lipid staining protocols and consider generating transgenic lines with fluorescently tagged fitm1 for real-time visualization.

By addressing these considerations, researchers can develop robust zebrafish models for studying fitm1 function in the context of whole-organism lipid metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.