Recombinant Danio rerio Fat storage-inducing transmembrane protein 2 (fitm2)

Shipped with Ice Packs
In Stock

Description

Lipid Binding Specificity

Recombinant FITM2 binds neutral glycerolipids with high specificity:

LipidBinding AffinityCompetitive Inhibition
Triacylglycerol (TAG)~100–250 nMYes (IC₅₀ for TAG: 100 nM)
Diacylglycerol (DAG)~100–250 nMYes
Cholesteryl Oleate (CO)No bindingNo
Source:

Mutational studies reveal that residues like Asn80 are critical for TAG/DAG binding. For example, the N80A mutant reduces binding capacity by ~55%, correlating with smaller lipid droplets (LDs) in cellular models .

Enzymatic Activity

FITM2 exhibits acyl-CoA diphosphatase activity, hydrolyzing fatty acyl-CoAs (e.g., oleoyl-CoA) with:

  • Kₘ: 10 µM

  • Vₘₐₓ: 6.5 µmol/min/mg
    This activity is essential for ER membrane homeostasis and prevents toxic acyl-CoA accumulation .

Disease Modeling

  • Hepatic Steatosis: FITM2-knockout mice show elevated hepatic triglycerides, impaired lipoprotein secretion, and ER stress .

  • Lipodystrophy: Adipose-specific FITM2 deletion in mice causes progressive fat loss and metabolic dysfunction .

In Vitro Studies

Recombinant FITM2 is used to:

  1. Study LD biogenesis mechanisms in insect cells (e.g., Hi5 cells) .

  2. Investigate ER stress responses via its LPP (lipid phosphate phosphatase) activity .

Physiological Significance in Zebrafish

  • Expression Sites: Adaxial cells, slow muscle cells .

  • Functional Role: Regulates glucose homeostasis and pancreas regeneration .

  • Orthology Conservation: Retains 45% sequence identity with human FITM2, enabling cross-species mechanistic studies .

Key Research Findings

  • ER Homeostasis: FITM2 deficiency disrupts ER membrane morphology, leading to ER stress and impaired LD formation .

  • Dietary Modulation: High-fat diets exacerbate ER stress in FITM2-deficient models but paradoxically reduce hepatic steatosis .

  • Therapeutic Potential: Targeting FITM2 could address disorders like Siddiqi syndrome or metabolic liver diseases .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fitm2; fit2; zgc:110840; Acyl-coenzyme A diphosphatase FITM2; Fat storage-inducing transmembrane protein 2; Fat-inducing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
fitm2
Target Protein Sequence
MAAAVAGSLVDKLVCLWRQPYTRIYLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNL YFVKVSWGWTIVLLLPFIAYSNFYIKSHMFALRRLTSLLVATLVWYICTETFFYIEDITG SCYESNTMVVIRGEFDTKAACRKAGFFWDGFDISGHSFILSYSSLVIMEEMVPMLHIQPA YRNPPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYVKLF SPGLPPQPKQHT
Uniprot No.

Target Background

Function
Fat storage-inducing transmembrane protein 2 (FIT2) is a fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate. It preferentially hydrolyzes unsaturated long-chain acyl-CoA substrates within the endoplasmic reticulum (ER) lumen. This catalytic activity is crucial for maintaining ER structure and lipid droplets (LDs) biogenesis, which are lipid storage organelles vital for lipid and energy homeostasis. FIT2 is required for lipid droplet accumulation in the liver and intestine during embryogenesis. It may directly bind to diacylglycerol (DAGs) and triacylglycerol, which is also important for LD biogenesis. This protein may support directional budding of nascent LDs from the ER into the cytosol by reducing DAG levels at sites of LD formation. It may also play a role in regulating cell morphology, ER morphology, and cytoskeletal organization.
Gene References Into Functions
  1. Depletion of FIT2 in zebrafish blocks diet-induced accumulation of lipid droplets in the intestine and liver, highlighting its significant role in lipid droplet formation in vivo. PMID: 18160536
Database Links
Protein Families
FIT family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is FITM2 and what role does it play in zebrafish physiology?

FITM2 is an evolutionarily conserved protein that affects the formation of triglyceride lipid droplets (LDs). It is expressed predominantly in the endoplasmic reticulum (ER) of adipose tissues and plays an essential physiological role in fat storage in vivo . In zebrafish, as in other vertebrates, FITM2 facilitates the partitioning of triglycerides into lipid droplets without directly participating in triglyceride synthesis . The high degree of conservation of FITM2 across species underscores its fundamental importance in lipid metabolism .

How does zebrafish FITM2 compare structurally and functionally to mammalian FITM2?

Zebrafish FITM2 shares significant structural and functional homology with mammalian FITM2. Both are ER-resident proteins that mediate triglyceride-rich lipid droplet accumulation. Like its mammalian counterpart, zebrafish FITM2 does not synthesize triglycerides but rather facilitates their partitioning into lipid droplets . The conservation of function is evidenced by studies showing that chemicals affecting muscle development in zebrafish can be translated to human systems, suggesting similar underlying molecular mechanisms .

What is known about FITM2's molecular mechanism in lipid droplet formation?

FITM2 is localized to the endoplasmic reticulum and has been shown to directly bind triglycerides . Recent research suggests that FITM2 possesses acyl-CoA diphosphatase activity , which may be critical for its function. The exact mechanism by which FITM2 facilitates lipid droplet formation is still being elucidated, but knockout studies demonstrate that without FITM2, cells form fewer and smaller lipid droplets . There is evidence that FITM2 may serve as a regulator of triglyceride biosynthesis, highlighting its importance in lipid metabolism .

What are the optimal expression systems for producing recombinant zebrafish FITM2?

For recombinant zebrafish FITM2 expression, bacterial systems (E. coli) can be used for initial studies, but due to FITM2's transmembrane nature, eukaryotic expression systems often yield better results. For functional studies, insect cell systems (Sf9 or High Five cells) using baculovirus vectors are preferred as they provide proper membrane insertion and post-translational modifications. When studying protein-protein interactions or conducting functional assays, mammalian expression systems (HEK293 or CHO cells) may provide a more native-like environment for proper folding and function.

What purification strategies work best for maintaining FITM2 functionality?

As an integral membrane protein, FITM2 requires careful handling during purification. A recommended approach is to:

  • Use mild detergents (DDM, LMNG, or digitonin) for solubilization

  • Include lipids during purification to maintain stability

  • Employ affinity chromatography (His-tag or GST-tag) for initial capture

  • Follow with size exclusion chromatography for further purification

  • Verify protein integrity through Western blotting using anti-FITM2 antibodies

Maintaining an environment that mimics the ER membrane is crucial, as studies show that FITM2 disruption affects ER homeostasis .

How can researchers verify the functional integrity of purified recombinant FITM2?

Functional verification of purified FITM2 can be assessed through:

  • Triglyceride binding assay - FITM2 directly binds triglycerides

  • Acyl-CoA diphosphatase activity assay - measuring enzymatic activity as recently identified

  • Reconstitution into liposomes followed by lipid droplet formation assays

  • Complementation assays in FITM2-deficient cells to restore lipid droplet formation

Verification MethodReadoutAdvantagesLimitations
Triglyceride binding assayDirect binding measurementDirectly tests primary functionRequires pure protein
Acyl-CoA diphosphatase assayEnzymatic activityQuantitative measurementMay not reflect full in vivo function
Liposome reconstitutionLD formation visualizationMimics biological environmentComplex setup
Cell-based complementationRestoration of phenotypeMost physiologically relevantMany variables to control

What are the best methods to study FITM2's role in lipid droplet formation in zebrafish models?

Several approaches have proven effective for studying FITM2 function in zebrafish:

  • Fluorescent reporter systems: Utilizing transgenic zebrafish with fluorescently tagged lipid droplets allows visualization of LD formation in real-time during development .

  • CRISPR/Cas9 knockout models: Generating FITM2-deficient zebrafish enables assessment of loss-of-function phenotypes. Studies in mice have shown that FITM2 deficiency results in progressive lipodystrophy and metabolic dysfunction , and similar approaches can be applied in zebrafish.

  • High-throughput chemical screening: Testing compounds that influence LD formation, as demonstrated by the identification of forskolin and other chemicals that affect muscle development in zebrafish .

  • In vitro differentiation assays: Isolating and differentiating zebrafish adipocyte precursors to study FITM2's effects on LD formation, similar to studies showing that FITM2-deficient adipocyte precursors produce fewer but larger LDs .

How can researchers quantitatively assess the impact of FITM2 mutations on lipid metabolism?

Quantitative assessment of FITM2 mutations can be performed through:

  • Lipidomic analysis: Mass spectrometry-based approaches to measure changes in lipid profiles, including triglycerides, diacylglycerols, and phospholipids, as performed in mouse models .

  • Metabolic flux analysis: Tracking labeled fatty acids to measure rates of lipid synthesis, storage, and oxidation. Studies in FITM2-deficient mice showed reduced capacity to produce acid-soluble metabolites and CO₂ by oxidizing fatty acids .

  • Imaging-based quantification: Using Oil Red O staining or fluorescent lipid dyes combined with confocal microscopy to measure lipid droplet size, number, and distribution .

  • Triglyceride secretion assays: Measuring the impact on VLDL lipidation and secretion, as FITM2 deficiency in hepatocytes results in TG-depleted VLDL particles .

What assays can detect the interaction between FITM2 and other proteins involved in lipid metabolism?

Several methods can be employed to study FITM2 protein interactions:

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Proximity labeling techniques (BioID or APEX) for in vivo mapping of protein interactions

  • Membrane yeast two-hybrid systems adapted for membrane proteins

  • FRET/BRET assays to monitor real-time interactions in living cells

  • Split-protein complementation assays suitable for membrane protein interactions

The interaction studies should focus on known ER proteins involved in lipid metabolism, as FITM2 is exclusively localized to the ER and affects ER homeostasis .

How is zebrafish FITM2 being used as a model for understanding human metabolic disorders?

Zebrafish FITM2 serves as a valuable model for understanding human metabolic disorders through several approaches:

  • Modeling lipodystrophy: Studies in mice have shown that adipose-specific deficiency of FITM2 results in progressive lipodystrophy and metabolic dysfunction . Similar investigations in zebrafish can provide insights into human lipodystrophic conditions.

  • Studying non-alcoholic fatty liver disease (NAFLD): Research indicates that FITM2 deficiency can lead to lipid accumulation in the liver and may contribute to NAFLD and steatohepatitis, especially under dysmetabolic conditions .

  • Investigating the deafness-dystonia syndrome: Homozygous FITM2 deficiency in humans causes deafness-dystonia syndrome , and zebrafish models can help elucidate the underlying mechanisms.

  • Drug discovery platform: Chemicals identified in zebrafish screens have been successfully translated to human stem cell applications, as demonstrated by the use of forskolin and other compounds identified in zebrafish for human muscle cell therapy .

What insights has FITM2 research in zebrafish provided about the evolutionary conservation of lipid metabolism?

Research on FITM2 in zebrafish has revealed several key insights about evolutionary conservation:

  • The FIT protein family is present in most life forms, with FIT1 and FIT2 specifically present in mammals, highlighting their ancient evolutionary origins .

  • The high degree of conservation suggests fundamental roles in cellular metabolism across species .

  • The basic mechanism of FITM2 function in partitioning triglycerides into lipid droplets, rather than synthesizing them, appears to be conserved from zebrafish to mammals .

  • Chemical screens in zebrafish have identified compounds that affect muscle development that also work in human cells, demonstrating functional conservation across vertebrates .

How can FITM2 be utilized in regenerative medicine research?

FITM2 research in zebrafish has significant implications for regenerative medicine:

  • Stem cell differentiation: Chemicals identified in zebrafish that stimulate muscle development can be translated to human stem cell differentiation protocols. For example, forskolin, identified in zebrafish screens, was found to increase muscle stem cell numbers in mice and induce differentiation of human iPS cells into skeletal muscle .

  • Tissue engineering: Understanding FITM2's role in adipocyte development and function can inform strategies for engineering adipose tissue for reconstructive purposes.

  • Metabolic disease therapy: Insights into how FITM2 regulates lipid storage and metabolism can guide development of therapeutic approaches for metabolic disorders.

  • Drug discovery: The zebrafish model provides a platform for identifying compounds that modulate FITM2 function, potentially leading to novel therapeutics for lipid metabolism disorders.

What are the key considerations when designing CRISPR/Cas9 knockout or knockin strategies for zebrafish FITM2?

When designing genetic modification strategies for zebrafish FITM2, researchers should consider:

  • Target site selection:

    • Choose exons that encode functionally critical domains (e.g., transmembrane regions or lipid-binding sites)

    • Target early exons to maximize disruption probability

    • Avoid regions with potential off-target sites

  • Phenotypic analysis timing:

    • Plan for both early development and adult assessments

    • Consider that progressive lipodystrophy observed in mouse models may be age-dependent

    • High-fat feeding challenges may accelerate phenotype onset as seen in mouse models

  • Tissue-specific modifications:

    • Use tissue-specific promoters for conditional knockout/knockin approaches

    • Consider liver-specific modifications to study VLDL assembly effects

    • Target adipose tissue to investigate lipid storage functions

  • Control strategies:

    • Generate both homozygous and heterozygous models for dosage effect analysis

    • Include rescue experiments with wild-type and mutant FITM2 versions

How can researchers address the challenge of distinguishing between direct and indirect effects of FITM2 manipulation?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • Temporal control systems:

    • Employ inducible gene expression/knockout systems (e.g., Tet-On/Off)

    • Use temporally controlled CRISPR systems to modify FITM2 at specific developmental stages

    • Monitor immediate vs. delayed effects after FITM2 manipulation

  • Rescue experiments with domain mutants:

    • Generate structure-function relationship data by expressing mutant versions of FITM2

    • Target specific domains (e.g., triglyceride-binding or acyl-CoA diphosphatase domains)

    • Compare with full-length protein rescue

  • Multi-omics profiling:

    • Integrate transcriptomics, proteomics, and lipidomics data at various timepoints

    • Use pathway analysis to identify primary vs. secondary effects

    • Compare acute vs. chronic FITM2 deficiency profiles

  • Direct interaction verification:

    • Use proximity labeling in vivo to identify direct interaction partners

    • Perform in vitro binding assays with purified components

    • Validate with point mutations that specifically disrupt individual interactions

What experimental designs best address the complex interplay between FITM2, ER stress, and lipid metabolism?

To investigate the relationships between FITM2, ER stress, and lipid metabolism:

  • Integrated stress response analysis:

    • Monitor canonical ER stress markers (XBP1 splicing, ATF3, CHOP, BiP) as observed in FITM2-deficient livers

    • Assess phosphorylation status of eIF2α, which was ~threefold greater in FITM2-deficient livers

    • Use stress response inhibitors to determine causality vs. correlation

  • Subcellular fractionation studies:

    • Isolate ER fractions to analyze lipid composition directly

    • Perform electron microscopy to assess ER morphology changes

    • Use fluorescent reporters to track lipid movement between ER and lipid droplets

  • Metabolic flux analysis:

    • Trace labeled fatty acids and glycerol to track triglyceride synthesis and partitioning

    • Measure fatty acid oxidation capacity as this was reduced in FITM2-deficient liver lysates

    • Assess shifts in glucose vs. lipid utilization, as glycogen was decreased in FITM2-deficient mice

  • Lipoprotein assembly examination:

    • Analyze VLDL formation and secretion in hepatocytes

    • Measure apoB100 lipidation status as FITM2 deficiency reduces this process

    • Monitor density distribution of lipoproteins as FITM2 deficiency shifts from VLDL to LDL density

Experimental ApproachParameters to MeasureExpected Outcomes in FITM2 Deficiency
ER stress analysisXBP1 splicing, ATF3, CHOP, BiP, p-eIF2αIncreased expression and phosphorylation
Lipid droplet characterizationNumber, size, distributionFewer but larger lipid droplets
Lipoprotein analysisVLDL-TG content, apoB100 levelsTG-depleted VLDL, shifted density profile
Fatty acid metabolismOxidation capacity, glycogen levelsReduced oxidation, decreased glycogen

What are common challenges in expressing functional recombinant zebrafish FITM2?

Researchers frequently encounter these challenges when working with recombinant FITM2:

  • Protein aggregation and misfolding:

    • FITM2 is an integral membrane protein with multiple transmembrane domains

    • Solution: Use mild detergents, include lipids during purification, and optimize buffer conditions

    • Consider fusion partners that enhance solubility while maintaining function

  • Low expression levels:

    • Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression system, use strong inducible promoters, and test multiple expression conditions (temperature, induction time)

    • Consider using specialized expression strains designed for membrane proteins

  • Functional verification:

    • Challenging to confirm activity of purified protein

    • Solution: Develop robust triglyceride binding assays and acyl-CoA diphosphatase activity tests

    • Use complementation assays in FITM2-deficient cells to verify functionality

  • Post-translational modifications:

    • Ensure expression system provides relevant modifications

    • Solution: Select appropriate eukaryotic expression systems when modifications are critical

    • Compare modification patterns between recombinant and native protein

How can researchers resolve discrepancies between in vitro and in vivo findings in FITM2 research?

Addressing discrepancies between experimental systems requires systematic approaches:

  • Physiological context reconstitution:

    • Supplement in vitro systems with relevant cofactors and interacting proteins

    • Use primary cells rather than cell lines when possible

    • Develop more complex 3D culture systems that better mimic tissue architecture

  • Cross-validation across models:

    • Compare findings between zebrafish, mouse models, and cell culture

    • Use multiple experimental approaches to test the same hypothesis

    • Consider species-specific differences in FITM2 function or regulation

  • Dosage and temporal considerations:

    • Acute vs. chronic manipulation may yield different results

    • Complete knockout vs. partial knockdown can reveal threshold effects

    • Developmental timing may influence outcomes, especially in zebrafish models

  • Environmental factors:

    • Consider diet effects, as high-fat diets accelerate phenotypes in FITM2-deficient mice

    • Control for metabolic state (fed vs. fasted) as this affects lipid metabolism

    • Account for stress responses that may mask or exacerbate FITM2-related phenotypes

What strategies help overcome technical limitations in studying FITM2 in lipid droplet dynamics?

Innovative approaches to overcome technical challenges include:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize ER-LD contact sites

    • Live-cell imaging with photoactivatable lipid probes

    • Correlative light and electron microscopy to link functional observations with ultrastructural details

  • Proximity labeling adaptations:

    • Use split-BioID or APEX systems compatible with membrane proteins

    • Target labeling specifically to ER-LD contact sites

    • Combine with mass spectrometry for proteome analysis at these interfaces

  • Reconstitution systems:

    • Develop artificial lipid bilayers incorporating purified FITM2

    • Use giant unilamellar vesicles to monitor lipid droplet budding events

    • Create minimal systems with defined components to identify essential factors

  • Computational modeling:

    • Develop predictive models of FITM2 structure and function

    • Simulate lipid droplet formation dynamics based on experimental parameters

    • Use machine learning to identify patterns in high-content imaging data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.