Recombinant Danio rerio Fatty acid desaturase 2 (fads2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life is dependent on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
fads2; fadsd6; Acyl-CoA 6-desaturase; Delta(5/Delta(6 fatty acid desaturase; D5D/D6D fatty acid desaturase; Delta-5/Delta-6 fatty acid desaturase; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MGGGGQQTDRITDTNGRFSSYTWEEVQKHTKHGDQWVVVERKVYNVSQWVKRHPGGLRIL GHYAGEDATEAFTAFHPNLQLVRKYLKPLLIGELEASEPSQDRQKNAALVEDFRALRERL EAEGCFKTQPLFFALHLGHILLLEAIAFMMVWYFGTGWINTLIVAVILATAQSQAGWLQH DFGHLSVFKTSGMNHLVHKFVIGHLKGASAGWWNHRHFQHHAKPNIFKKDPDVNMLNAFV VGNVQPVEYGVKKIKHLPYNHQHKYFFFIGPPLLIPVYFQFQIFHNMISHGMWVDLLWCI SYYVRYFLCYTQFYGVFWAIILFNFVRFMESHWFVWVTQMSHIPMNIDYEKNQDWLSMQL VATCNIEQSAFNDWFSGHLNFQIEHHLFPTVPRHNYWRAAPRVRALCEKYGVKYQEKTLY GAFADIIRSLEKSGELWLDAYLNK
Uniprot No.

Target Background

Function
Recombinant Danio rerio Fatty acid desaturase 2 (fads2) is a bifunctional fatty acid desaturase exhibiting delta-5 and delta-6 activities. It participates in lipid metabolism, catalyzing the biosynthesis of polyunsaturated fatty acids (PUFAs), showing a preference for n-3 substrates and exhibiting prominent Delta-6 function.
Gene References Into Functions
  1. Studies suggest that Z-FADS, the sole fatty acid desaturase identified in zebrafish, functions as a universal fatty acid desaturase during lipogenesis. PMID: 24103751
  2. Significant upregulation of desaturase expression has been observed during oocyte maturation. PMID: 19025614
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of zebrafish FADS2?

Zebrafish FADS2 is a hydrophobic membrane-bound protein with a molecular weight of approximately 52.4 kDa comprising 444 amino acids . The protein contains a cytochrome b5-like domain on the N-terminus and a main desaturation domain with three histidine-rich regions on the C-terminus . The histidine residues within these regions hold two iron atoms in the active site and are highly conserved among desaturases . The fusion of the cytochrome b5-like domain to the main desaturase domain enables direct electron transfer from NADH cytochrome b5 reductase to the catalytic site of FADS2 via the cytochrome b5-like domain . Both the cytochrome b5-like domain (which contains a highly conserved heme-binding HPGG motif) and microsomal cytochrome b5 are necessary for proper Δ6 desaturation activity .

How does zebrafish FADS2 differ from mammalian FADS2?

While mammals possess separate genes encoding distinct desaturases (FADS1 with Δ5 activity and FADS2 with Δ6 activity), fish have lost the FADS1 gene during evolution . Consequently, zebrafish possess a single FADS2 enzyme that performs multiple desaturation activities, including both Δ6 and Δ5 functions . This bifunctional capability represents an evolutionary adaptation that allows zebrafish to synthesize LC-PUFAs despite having a reduced gene repertoire compared to mammals . Additionally, zebrafish FADS2 represents the sole enzyme with desaturation activity towards PUFAs in this species, making it particularly important for LC-PUFA biosynthesis .

What subcellular localization patterns does FADS2 exhibit?

FADS2 primarily localizes to the endoplasmic reticulum membranes as part of a cytochrome b5-containing trimeric complex . Studies using GFP tagging systems have shown that FADS2 also localizes to mitochondria, which has been verified through Western blot analysis of isolated intact mitochondria using antibodies against GFP, COX IV, PDI, and β-actin . This dual localization pattern may have functional implications for the enzyme's role in fatty acid metabolism across different cellular compartments.

What expression systems are most effective for producing functional recombinant zebrafish FADS2?

For functional characterization of zebrafish FADS2, heterologous expression in yeast (Saccharomyces cerevisiae) has proven particularly effective . This system allows for the assessment of enzyme activities by introducing the FADS2 gene into yeast cells, which are then supplemented with appropriate fatty acid substrates to evaluate desaturation capabilities. For mammalian cell-based studies, stable transformation of human cell lines (such as MCF-7) lacking functional FADS2 has been successfully employed to express recombinant FADS2 . When expressing membrane proteins like FADS2, it's crucial to consider that as a hydrophobic membrane-bound protein, FADS2 is "extremely recalcitrant to characterization by conventional biochemical methods" , which presents challenges for purification and structural studies.

What strategies can overcome the challenges of expressing membrane-bound proteins like FADS2?

Given FADS2's nature as a membrane-bound protein, several strategies can enhance recombinant expression:

  • Use of specialized expression vectors containing strong promoters appropriate for the host system

  • Optimization of codon usage for the expression host

  • Addition of fusion tags (such as His6 or GST) that facilitate purification while minimizing interference with enzymatic activity

  • Expression at lower temperatures (16-20°C) to allow proper protein folding

  • Use of detergents or solubilizing agents during extraction and purification steps

When studying FADS2 localization or interaction with other proteins, GFP-tagging approaches have proven successful, as demonstrated in studies where FADS2-GFP fusion proteins (73 kDa: 46 kDa FADS2 + 27 kDa GFP) were detected in both ER and mitochondrial fractions .

How can the distinct desaturase activities of zebrafish FADS2 be assayed experimentally?

Zebrafish FADS2 exhibits multiple desaturase activities (Δ6, Δ5) that can be assayed through several complementary approaches:

  • Heterologous expression in yeast: Express zebrafish FADS2 in S. cerevisiae, then supplement with appropriate fatty acid substrates and analyze the fatty acid profiles using gas chromatography (GC) and mass spectrometry (MS) .

  • Stable transformation in mammalian cells: Create stable cell lines expressing FADS2 and perform substrate conversion assays by adding potential fatty acid substrates to the medium and measuring product formation over time .

  • Pulse-chase experiments: Apply substrate fatty acids as a pulse (e.g., 100 μM for 1 hour), replace with regular medium, and analyze cellular fatty acid profiles at different time points to track conversion rates and intermediates .

For example, when 22:4n-6 was applied to FADS2-expressing cells as a pulse, synthesis of 22:5n-6 was observed before 24:5n-6 became detectable, indicating direct Δ4 desaturation activity rather than elongation followed by desaturation .

What pathways for LC-PUFA biosynthesis involve zebrafish FADS2?

Zebrafish FADS2 participates in multiple pathways for LC-PUFA biosynthesis:

  • Classical Δ6 pathway: Δ6 desaturation → elongation → Δ5 desaturation, producing EPA and ARA from shorter-chain precursors .

  • Alternative Δ8 pathway: Elongation → Δ8 desaturation → Δ5 desaturation, providing an alternative route to EPA and ARA .

  • Direct Δ4 desaturation pathway: Direct conversion of 22:5n-3 to 22:6n-3 (DHA) and 22:4n-6 to 22:5n-6 through Δ4 desaturation .

  • Sprecher pathway: Involves elongation of C22 PUFAs to C24 PUFAs, followed by Δ6 desaturation and β-oxidation in peroxisomes, resulting in a net Δ4 desaturation .

The existence of multiple pathways demonstrates the remarkable metabolic flexibility of zebrafish FADS2 and its central importance in LC-PUFA biosynthesis.

How can CRISPR/Cas9 be used to create zebrafish fads2 knockout models?

CRISPR/Cas9 genome editing has been successfully applied to create zebrafish fads2 mutants, as described in recent studies . The procedure involves:

  • Designing a single guide RNA (sgRNA) targeting the zebrafish fads2 gene, particularly sequences flanking the ATG start codon to prevent transcription of functional FADS2 protein.

  • In one reported approach, researchers used the sgRNA sequence 5′-GTTCAGAGATCAGCGATGGG-3′ designed according to the zebrafish fads2 gene (zfin.org/ZDB-GENE-011212-1) .

  • The sgRNA and Cas9 endonuclease are introduced into zebrafish embryos, where Cas9 unwinds the genomic DNA duplex and creates double-strand breaks at the specific site recognized by the sgRNA.

  • These breaks are repaired by non-homologous end joining, often resulting in insertions or deletions that disrupt the gene function.

  • Confirming successful mutation through PCR amplification of the fads2 gene region and subsequent sequencing or gel electrophoresis to identify mutations.

This approach allows researchers to study the effects of partial or complete loss of FADS2 function on zebrafish development, reproduction, and fatty acid metabolism.

What reproductive phenotypes are associated with fads2 deficiency in vertebrate models?

Fads2 knockout studies in mice have revealed critical roles in reproduction, with both male and female fads2-/- mice being sterile . The specific reproductive phenotypes include:

In males:

  • Marked hypogonadism with testes weight reduced to two-thirds of age-matched wild-type littermates

  • Arrested spermatogenesis at the stage of round haploid spermatids

  • Failure of spermatids to complete acrosome and tail formation

  • Absence of mature spermatozoa in the lumen of seminiferous tubules and epididymis

In females:

  • Infertility, although the specific mechanisms have not been as thoroughly characterized as in males

While comprehensive studies on the reproductive effects of fads2 knockout in zebrafish are still limited, the essential role of FADS2 in reproductive health appears to be conserved across vertebrate species . This suggests that LC-PUFAs synthesized through FADS2 activity are crucial for proper germ cell development and reproductive function.

How does zebrafish FADS2 substrate specificity compare to FADS2 from other fish species?

Substrate specificities of FADS2 vary considerably among fish species, reflecting evolutionary adaptations to different dietary environments . These variations include:

  • Monofunctional vs. bifunctional desaturases: While some fish species possess FADS2 enzymes with single desaturase activities (e.g., only Δ6), zebrafish FADS2 exhibits both Δ6 and Δ5 activities, making it bifunctional .

  • Additional desaturase activities: Some fish FADS2 enzymes have evolved Δ4 desaturase activity, allowing direct synthesis of DHA from EPA through a single step rather than requiring the more complex Sprecher pathway .

  • Δ8 desaturation capability: Zebrafish FADS2, along with FADS2 from several other fish species, can perform Δ8 desaturation, providing an alternative pathway for LC-PUFA synthesis .

These variations in substrate specificity are hypothesized to result from functionalization processes that occurred in response to dietary availability in natural prey species during evolution .

What evolutionary patterns are observed in fish FADS2 enzymes?

Recent evolutionary analyses have revealed fascinating patterns in fish FADS2 genes:

  • Loss of FADS1: Unlike mammals, which have distinct FADS1 (Δ5) and FADS2 (Δ6) genes, fish have lost the FADS1 gene during evolution, requiring FADS2 to perform multiple desaturation functions .

  • Two distinct desaturase repertoires: Teleost fish exhibit two types of desaturase repertoires, with Elopomorpha having a different pattern compared to other living teleost lineages .

  • Functional plasticity: Fish FADS2 enzymes show remarkable plasticity in their substrate specificity, which is considered an adaptation to varying dietary availability of LC-PUFAs in different aquatic environments .

  • Conservation of key structural elements: Despite functional diversification, certain structural features remain highly conserved, including the three histidine-rich regions that coordinate iron atoms at the active site and the HPGG motif in the cytochrome b5-like domain .

This evolutionary history explains the exceptional versatility of zebrafish FADS2 and its ability to perform multiple desaturation activities that require separate enzymes in mammals.

What are the physiological consequences of fads2 deficiency in zebrafish models?

While comprehensive studies on fads2-deficient zebrafish are still emerging, research on other vertebrate models suggests several physiological consequences:

  • Reproductive defects: Based on mouse models, fads2 deficiency leads to sterility in both males and females, with specific defects in spermatogenesis and potentially oogenesis .

  • Altered LC-PUFA profiles: Reduced or absent FADS2 activity would significantly impair the endogenous biosynthesis of LC-PUFAs such as EPA, DHA, and ARA, making the organism more dependent on dietary sources of these essential fatty acids.

  • Developmental impacts: LC-PUFAs serve essential functions as membrane components, energy sources, and signaling molecules, so their deficiency may affect various developmental processes, particularly in neural and visual systems where DHA is highly concentrated.

  • Metabolic pathway alterations: Partial fads2 knockout in zebrafish has been shown to divert LC-PUFA biosynthesis via alternative pathways, demonstrating metabolic adaptation in response to enzyme deficiency .

How do experimental conditions affect recombinant FADS2 activity measurements?

Several experimental factors can significantly influence measurements of recombinant FADS2 activity:

  • Expression system selection: Different expression systems (yeast, mammalian cells, insect cells) may produce FADS2 with varying activity levels due to differences in post-translational modifications, membrane composition, and cofactor availability.

  • Substrate concentration and delivery: The concentration and method of delivering fatty acid substrates can affect activity measurements, as high concentrations may be toxic while low concentrations may limit reaction rates. Typically, substrate concentrations around 100 μM with appropriate delivery methods (complexed with albumin or in appropriate solvents) are used .

  • Incubation time: For pulse-chase experiments, the timing of sample collection is critical, as demonstrated by studies showing the appearance of certain fatty acid products only after specific time points (e.g., 24:5n-6 appearing only after 12 hours in cells exposed to 22:4n-6) .

  • Cofactor availability: Ensuring sufficient availability of essential cofactors, including NADH and cytochrome b5, is crucial for optimal FADS2 activity .

  • Membrane environment: As a membrane-bound protein, FADS2 activity is influenced by the lipid composition of the membranes in the expression system, which may differ from its native environment.

Carefully controlling these variables is essential for obtaining reliable and reproducible measurements of FADS2 activity in recombinant systems.

How can structural modeling enhance our understanding of zebrafish FADS2 function?

Despite the absence of a three-dimensional structure of FADS2 determined by X-ray crystallography , structural modeling approaches can provide valuable insights:

  • Homology modeling: Using the crystal structures of related desaturases, such as human and rat stearoyl-CoA desaturase (SCD1) with Δ9 desaturation activity, as templates for predicting FADS2 structure .

  • Conservation analysis: Identifying highly conserved residues, particularly those within the three His-boxes that coordinate iron atoms at the active site and are in close proximity to fatty acid substrates (referred to as "contact residues") .

  • Substrate docking simulations: Computational modeling of substrate binding to predict how different fatty acids interact with the enzyme active site, potentially explaining the diverse desaturase activities observed in zebrafish FADS2.

  • Mutation effect prediction: In silico analysis of how specific mutations might affect protein structure and function, guiding experimental design for site-directed mutagenesis studies.

These approaches can help predict structural features that determine substrate specificity and catalytic efficiency, informing experimental efforts to engineer FADS2 with enhanced or altered activities.

What strategies can optimize recombinant FADS2 expression for structural studies?

Structural studies of membrane proteins like FADS2 present significant challenges . Advanced strategies to overcome these limitations include:

  • Protein engineering approaches:

    • Removal of flexible regions that might hinder crystallization

    • Introduction of thermostabilizing mutations

    • Fusion with crystallization chaperones or domains that facilitate crystal formation

  • Alternative expression systems:

    • Insect cell expression using baculovirus vectors

    • Cell-free expression systems with supplied lipids or detergents

    • Specialized yeast strains with modified membrane compositions

  • Advanced purification methods:

    • Lipid nanodiscs to maintain the protein in a native-like membrane environment

    • Amphipols as alternatives to detergents for membrane protein stabilization

    • Styrene maleic acid copolymer (SMA) extraction to isolate membrane proteins with their surrounding lipids

  • Cryo-electron microscopy:

    • Single particle analysis, which requires less protein than crystallography and can handle more conformational heterogeneity

    • Advances in direct electron detectors and image processing software have made cryo-EM increasingly viable for membrane proteins of the size of FADS2

These approaches may help overcome the current limitations in structural characterization of FADS2, potentially leading to a better understanding of its multiple desaturase activities and substrate specificities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.