Recombinant Danio rerio Gap junction alpha-1 protein (gja1)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Gap junction alpha-1 protein (gja1) is encoded by the gja1 gene, which belongs to the connexin family. It facilitates the formation of gap junctions—channels enabling direct transfer of ions, metabolites, and signaling molecules between adjacent cells . In zebrafish, this protein regulates cardiac function, bone growth, and tissue development .

Key Features:

PropertyDetail
Gene Namegja1 (synonyms: cx43, shf, sof)
Protein NameGap junction alpha-1 protein (Connexin-43/Cx43)
UniProt IDO57474
Sequence Length381 amino acids (full-length mature protein)
DomainsFour transmembrane domains, two extracellular loops, and cytoplasmic N-/C-termini

Recombinant Production

Recombinant zebrafish Cx43 is typically expressed in E. coli or mammalian systems for research applications.

Functional and Research Applications

Recombinant zebrafish Cx43 is pivotal for studying developmental biology and disease mechanisms.

Key Research Findings:

  • Cardiac Development: Morpholino-mediated knockdown of Cx43 in zebrafish causes heart folding defects, reduced hematopoiesis, and microphthalmia .

  • Bone Growth: Cx43 regulates osteoblast activity and fin bone segmentation in zebrafish .

  • Disease Modeling: Mutations in gja1 are linked to human disorders like oculodentodigital dysplasia (ODDD) and craniometaphyseal dysplasia, making zebrafish Cx43 a model for these conditions .

Pathways Involving Cx43:

PathwayRole of Cx43Related Proteins
Gap Junction AssemblyChannel formation and intercellular communicationGJA5, GJB2, PANX2
Cardiac ConductionSynchronized heart contractionGJA5, CACNA2D2, ITGB4
Bone MorphogenesisOsteoblast differentiationPDGFRA, CSNK1DB

Technical Notes

  • Storage Stability: Avoid repeated freeze-thaw cycles; aliquot for long-term use .

  • Activity Assays: Used in ELISA kits (e.g., MyBioSource MBS1100602) to quantify Cx43 in serum or tissues .

  • Interactions: Binds to TJP1, SRC, and DSC2, influencing cell adhesion and signaling .

Case Studies

  • Heart Defects: A study using recombinant Cx43 demonstrated that disrupted gap junctions impair cardiac conduction, leading to arrhythmias in zebrafish embryos .

  • Bone Development: Overexpression of Cx43 in osteoblasts increased bone density in zebrafish fin regeneration models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: Our standard shipping method utilizes blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
gja1; cx43; shf; sof; Gap junction alpha-1 protein; Connexin-43; Cx43; Short fin protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-381
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
GDWSALGRLLDKVQAYSTAGGKVWLSVLFIFRILVLGTAVESAWGDEQSAFKCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSTPTLLYLAHVFYLMRKEEKLNRKEEELKAVQNDGG DVELHLKKIELKKFKHGLEEHGKVKMKGSLLRTYIFSIIFKSICEVVFLVIQWYLYGFSL SAVYTCERTPCPHRVDCFLSRPTEKTIFIIFMLVVSLFSLLLNIIELFYVLFKRIKDRVK SRQNTQFPTGTLSPTPKELSTTKYAYYNGCSSPTAPLSPMSPPGYKLATGERTNSCRNYN KQANEQNWANYSTEQNRLGQNGSTISNSHAQAFDYPDDTHEHKKLTPGHELQPLALIDAR PCSRASSRMSSRARPDDLDV
Uniprot No.

Target Background

Function
Gap junctions are formed by clusters of closely packed pairs of transmembrane channels, known as connexons. These channels allow the diffusion of low molecular weight materials between adjacent cells. Connexin43 plays a crucial role in gap junction communication within the ventricles and is involved in regulating fin bone size and growth.
Gene References Into Functions
  1. Studies have identified Connexin43 (Cx43) as the gene responsible for the "short-of-fin" (sof) phenotype, characterized by shorter fin ray segments with normal vertebrae. PMID: 27129238
  2. Serpinh1b, a gene encoding the molecular chaperone Hsp47, functions downstream of Cx43. Hsp47 is essential for proper folding of procollagen molecules. PMID: 26103547
  3. The extracellular matrix protein Hapln1a stabilizes the secreted growth factor Semaphorin3d (Sema3d), which has been independently shown to mediate Cx43-dependent phenotypes during regeneration. PMID: 26828861
  4. Hapln1a plays a critical role in Cx43-dependent growth and patterning of the regenerating fin skeleton. PMID: 24533114
  5. Increased expression of Cx43 is observed in Dupuytren's disease. PMID: 24359029
  6. Sema3d functions in a common molecular pathway with Cx43, regulating cell proliferation and joint formation. PMID: 22542598
  7. Fibroblasts from patients with ossification of the posterior longitudinal ligament (OPLL) exhibit osteogenic characteristics, with Cx43 playing a significant role. PMID: 21311398
  8. Cardiomyogenesis is influenced by stimuli from the cellular microenvironment, with Cx43 potentially playing a significant role. PMID: 21931658
  9. Studies have demonstrated cross-talk between IGF-1R and AT-1R in AT-II and IGF-1-induced Cx43 expression in SV SMCs, involving Erk 1/2 and downstream activation of the AP-1 transcription factor. PMID: 20731749
  10. Alterations in astrocyte connexins may be implicated in the suicide process, further supporting the involvement of astrocytes in psychopathology. PMID: 21571253
  11. Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblasts relies on Cx43 rather than Cx45. PMID: 21674053
  12. Cx43 is critical for tight junction reassembly at the blood-testis barrier during its cyclic restructuring throughout the seminiferous epithelial cycle of spermatogenesis. PMID: 20921394
  13. Neonatal murine atrial myocytes exhibit similar abundances of Cx40 and Cx43 proteins, while ventricular myocytes contain at least 20 times more Cx43 than Cx40. PMID: 19486903
  14. In studied colon tumors, there is either a lack of membranous distribution of connexins or a shift from moderate membranous immunoreactivity to predominantly cytoplasmic accumulation of CX32 and CX43. PMID: 20133984
  15. Cx48.5, Cx44.1, and Cx43 play roles in lens development. PMID: 14648847
  16. The "short fin" (sof) mutant, causing defects in the length of bony fin ray segments, is attributed to mutations in the connexin43 (cx43) gene. PMID: 15649473
  17. Molecular cloning suggests that Cx43alpha1 gap junctions likely have conserved roles in vertebrate embryonic development. PMID: 15895415
  18. Measurable differences in Cx43 function may be correlated with the severity of bone length defects. PMID: 17599838
  19. Connexin43 (GJA1) is required for the population of dividing cells during fin regeneration. PMID: 18406403
  20. Results indicate a correlation between Cx43 expression levels in the fin ray mesenchyme and the location of joints during zebrafish development. PMID: 19150347
  21. The role of Cx43.4 appears to be conserved, as its ortholog, human Cx45, can functionally compensate for zebrafish Cx43.4 during left-right patterning. PMID: 19799895

Show More

Hide All

Database Links

KEGG: dre:30236

STRING: 7955.ENSDARP00000061260

UniGene: Dr.75809

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in adult ovary, heart, lens and liver. In growing caudal fins, expressed in cells flanking the germinal region of newly growing segments and in osteoblasts at segment boundaries.

Q&A

What is the basic structure of Danio rerio gja1 protein and how does it compare to mammalian homologs?

Danio rerio gja1 is a connexin family protein that forms gap junction channels between adjacent cells. Like mammalian connexins, it contains four transmembrane domains, two extracellular loops, a cytoplasmic loop, and cytoplasmic N- and C-terminal regions. The C-terminus of gja1 contains a 10-amino acid sequence (amino acids 234-243) that serves as a tubulin-binding sequence, which is unique to GJA1 and not conserved in other gap junction protein families . This sequence plays a critical role in the protein's ability to interact with the cytoskeleton and regulate processes beyond simple gap junction formation.

Gap junctions can be homomeric (composed of identical connexin subunits) or heteromeric (composed of different connexin subunits). In zebrafish, evidence suggests that gja1 can form functional heteromeric channels with other connexins, similar to mammalian systems. These structural features are essential for understanding the protein's diverse functions in development and physiology.

What methodologies are recommended for distinguishing between gap junction-dependent and independent functions of recombinant Danio rerio gja1?

To distinguish between channel-dependent and independent functions of recombinant Danio rerio gja1, researchers should employ multiple complementary approaches:

  • Dominant-negative mutants: Use established dominant-negative mutants with specific functional deficits. The T154A point mutation mimics the closed-channel status without inhibiting gap junction formation, while the Δ130-136 deletion blocks gap junction permeability . The Δ234-243 deletion affects the tubulin-binding sequence specific to GJA1 .

  • Rescue experiments: Perform comparative rescue experiments with wild-type and mutant constructs in knockdown models. For example, morpholino-mediated knockdown of gja1 in zebrafish can be rescued with mismatched mRNA encoding wild-type gja1, while dominant-negative mutants fail to rescue the phenotypes .

  • Co-immunoprecipitation assays: Use co-IP to identify protein interactions that may mediate non-gap junction functions. As demonstrated with Rab11a, gja1 has protein-protein interactions that extend beyond gap junction formation .

  • Live imaging: Track fluorescently tagged wild-type and mutant gja1 proteins to observe differences in trafficking, localization, and protein-protein interactions.

This methodological approach allows researchers to parse the multifaceted functions of gja1 and attribute phenotypes to specific molecular mechanisms.

What are the optimal expression systems for producing functional recombinant Danio rerio gja1 protein?

For producing functional recombinant Danio rerio gja1, researchers should consider several expression systems based on experimental objectives:

  • Mammalian expression systems (e.g., HEK293, CHO cells): These provide proper post-translational modifications and membrane insertion critical for connexin function. These systems are ideal when studying trafficking, gap junction formation, or interactions with mammalian proteins.

  • Xenopus oocyte system: Useful for electrophysiological studies of channel function. This system provides a clean background for functional studies as demonstrated in research employing dominant-negative gja1 mutants .

  • Bacterial systems: While challenging due to the membrane protein nature of gja1, bacterial systems can produce truncated versions or specific domains for structural studies or antibody production.

  • Baculovirus-insect cell system: A compromise between bacterial and mammalian systems, providing some post-translational modifications while allowing higher protein yields.

For functional studies, the inclusion of appropriate tags (e.g., FLAG, as used in mismatch gja1 mRNA validation experiments) can facilitate purification and detection without compromising function . When designing expression constructs, researchers should consider that modifications near the C-terminal tubulin-binding domain may affect interaction with cytoskeletal elements and non-canonical functions.

What are the advanced methodologies for assessing the quality and functionality of purified recombinant Danio rerio gja1?

To thoroughly assess recombinant Danio rerio gja1 functionality, researchers should implement a multi-faceted approach:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Size-exclusion chromatography to confirm proper oligomerization

    • Western blotting with conformation-specific antibodies

  • Membrane incorporation analysis:

    • Liposome reconstitution assays

    • Electron microscopy to visualize hexameric channel formation

  • Functional analysis:

    • Dye transfer assays (e.g., Lucifer yellow) in transfected cells to assess channel permeability

    • Electrophysiological techniques to measure channel conductance

    • Assessment of protein-protein interactions with known binding partners like Rab11

  • Rescue capability testing:

    • Functional complementation in gja1-deficient cells or organisms

    • Quantitative assessment of phenotype rescue efficiency in morphant or CRISPR/Cas9 mutant models

The successful recombinant protein should demonstrate proper folding, oligomerization capacity, membrane localization, channel functionality, and ability to engage in expected protein-protein interactions to be considered fully functional.

How does Danio rerio gja1 contribute to stripe pattern formation in zebrafish?

While the search results primarily discuss the role of Connexin 41.8 (encoded by leopard/leo) and Connexin 39.4 (encoded by luchs) in zebrafish stripe formation , the involvement of gja1 in cellular patterning mechanisms warrants investigation. The developmental patterning in zebrafish requires complex intercellular communication between pigment cell types, which is facilitated by gap junctions.

Research indicates that mutations in leo, encoding Connexin 41.8, create spotted patterns instead of stripes in zebrafish. A dominant leo allele can completely eliminate the pattern, suggesting dominant negative effects on another gap junction component, identified as Connexin 39.4 (luchs) . These findings demonstrate the crucial role of gap junction-mediated communication in pattern formation.

For researchers investigating gja1's potential role in this process, the following experimental approaches are recommended:

  • Generate tissue-specific gja1 knockout or knockdown models

  • Perform co-expression studies with leo and luchs

  • Analyze potential heteromeric gap junction formation between gja1 and other connexins

  • Conduct cell-type specific rescue experiments in gja1-deficient backgrounds

These approaches would help determine whether gja1 participates in the gap junction complexes that regulate pigment cell interactions during stripe formation.

What experimental approaches best elucidate the role of gja1 in zebrafish cardiac development and function?

To investigate gja1's role in zebrafish cardiac development and function, researchers should implement a comprehensive experimental strategy:

  • Temporal-spatial expression analysis:

    • In situ hybridization to map gja1 expression throughout cardiac development

    • Immunohistochemistry with anti-gja1 antibodies to localize the protein in developing and mature cardiac tissues

  • Loss-of-function studies:

    • Morpholino-mediated knockdown with cardiac-specific analysis

    • CRISPR/Cas9-mediated mutagenesis targeting conserved regions (similar to approaches used in ciliary studies )

    • Dominant-negative mutant expression (T154A, Δ130-136, Δ234-243)

  • Functional assessments:

    • Electrocardiogram recordings to detect arrhythmias and conduction abnormalities

    • High-speed video microscopy to assess cardiac contractility

    • Calcium imaging to evaluate excitation-contraction coupling

  • Molecular pathway analysis:

    • Analysis of Rab11 and Rab8 trafficking pathways in cardiac tissue, given their interaction with gja1

    • Assessment of gap junction formation at intercalated discs

Based on mammalian studies, gja1 mutations can cause severe cardiac phenotypes including abnormal electrocardiograms and increased ventricular ectopy . The M213L mutation in mice prevents GJA1-20k production, leading to reduced gap junctions and sudden cardiac death . Therefore, zebrafish models investigating both full-length gja1 and potential truncated isoforms would provide valuable insights into cardiac development and function.

What methods effectively characterize the interaction between Danio rerio gja1 and the Rab11-Rab8 trafficking pathway?

To characterize gja1 interactions with the Rab11-Rab8 trafficking pathway, researchers should employ these validated methodologies:

  • Co-immunoprecipitation assays: These have successfully demonstrated physical interaction between GJA1 and Rab11a or Rab8a proteins . For recombinant Danio rerio gja1, researchers should use epitope-tagged constructs and perform reciprocal co-IPs followed by Western blotting.

  • Advanced microscopy techniques:

    • Structured illumination microscopy (SIM) to visualize Rab11-positive vesicles encircling the base of ciliary axonemes

    • Confocal microscopy to assess co-localization of gja1 with Rab11 in pericentriolar regions

    • Live-cell imaging with fluorescently tagged proteins to track dynamic interactions

  • Functional perturbation studies:

    • Expression of dominant-negative Rab proteins to assess effects on gja1 trafficking

    • Analysis of gja1 mutants (T154A, Δ130-136, Δ234-243) for their ability to interact with Rab11a

    • siRNA-mediated knockdown of Rab proteins with rescue experiments

  • Trafficking assays:

    • Pulse-chase experiments to track gja1 movement through cellular compartments

    • Biotinylation assays to quantify surface expression of gja1

    • RUSH (Retention Using Selective Hooks) system to monitor synchronized trafficking

Research has shown that GJA1 depletion affects Rab11 localization and protein levels, with dominant-negative GJA1 mutants failing to interact with Rab11a . These findings suggest that gja1's role extends beyond gap junction formation to include regulation of trafficking pathways critical for processes like ciliogenesis.

How can researchers distinguish between membrane-associated and cytoplasmic pools of recombinant Danio rerio gja1 in experimental systems?

To effectively distinguish between membrane-associated and cytoplasmic pools of recombinant Danio rerio gja1, researchers should implement these methodological approaches:

  • Biochemical fractionation:

    • Differential centrifugation to separate membrane and cytosolic fractions

    • Density gradient centrifugation for more refined separation of cellular compartments

    • Western blot analysis of fractions using anti-gja1 antibodies

  • Imaging approaches:

    • Confocal microscopy with membrane markers (e.g., N-cadherin) and gja1 co-staining

    • Total Internal Reflection Fluorescence (TIRF) microscopy to visualize membrane-proximal proteins

    • Super-resolution microscopy for precise localization

  • Protein modification strategies:

    • Surface biotinylation followed by streptavidin pull-down to isolate membrane-associated gja1

    • Split-GFP complementation assays with one fragment targeted to specific cellular compartments

  • Half-life determination:

    • Pulse-chase experiments comparing degradation rates of membrane vs. cytoplasmic gja1

    • Cycloheximide chase assays with fractionation to track protein stability in different compartments

Particularly relevant is the finding that cytoplasmic Cx43 (mammalian homolog of gja1) has a half-life approximately 50% shorter than membrane-associated Cx43 . This differential stability has significant implications for experimental design when studying gja1 trafficking and turnover. Without proper trafficking support (such as from GJA1-20k in mammalian systems), poorly trafficked Cx43 is degraded , suggesting researchers should monitor both localization and degradation pathways when studying recombinant gja1.

What experimental designs best elucidate the function of Danio rerio gja1 in ciliogenesis?

To investigate Danio rerio gja1's role in ciliogenesis, researchers should implement these methodological approaches:

  • In vivo models:

    • Morpholino-mediated knockdown of gja1 in zebrafish embryos with quantitative analysis of ciliary formation

    • CRISPR/Cas9-mediated F0 mutagenesis targeting gja1 in zebrafish

    • Dominant-negative mutant expression (T154A, Δ130-136, Δ234-243) with analysis of ciliary phenotypes

    • Rescue experiments using mismatched gja1 mRNA to demonstrate specificity

  • Cell culture models:

    • siRNA-mediated knockdown in human RPE1 cells with serum starvation to induce ciliogenesis

    • Rescue experiments with siRNA-non-targetable gja1 constructs

    • Expression of fluorescently tagged gja1 to track localization during ciliogenesis

  • Ciliary analysis techniques:

    • Immunofluorescence using acetylated tubulin antibodies to visualize ciliary axonemes

    • Quantification of cilia number, length, and morphology

    • Isolation of cilia from wild-type versus mutant/knockdown models for detailed analysis

  • Molecular pathway assessment:

    • Analysis of CP110 removal from mother centrioles during ciliogenesis

    • Evaluation of BBS4 localization in pericentriolar material

    • Investigation of Rab11 localization and function in ciliary vesicle formation

Research has demonstrated that gja1 depletion affects both primary and motile cilia formation, without affecting cell fate determination of multiciliated cells . This suggests that gja1 functions specifically in the ciliogenesis process rather than in developmental specification.

How do mutations in the tubulin-binding domain of Danio rerio gja1 specifically affect ciliary functions compared to other functional domains?

The differential effects of mutations in gja1's tubulin-binding domain versus other functional domains provide insight into domain-specific contributions to ciliary function:

  • Comparative analysis of domain-specific mutations:

    MutationDomain AffectedGap Junction FormationCiliary PhenotypeRab11 InteractionReference
    T154AChannel gatingNot inhibitedSevere defects in cilia formationInteraction lost
    Δ130-136Intracellular loopBlocked gap junction permeabilitySevere defects in cilia formationInteraction lost
    Δ234-243Tubulin-binding domainNot directly assessedMost severe reduction in ciliated cell numbersInteraction lost
  • Methodological approach to domain analysis:

    • Express domain-specific mutants in gja1-depleted backgrounds

    • Quantify ciliary parameters including length, number, and ultrastructure

    • Assess interactions with trafficking machinery (Rab11, Rab8)

    • Evaluate cytoskeletal organization around basal bodies

  • Tubulin-binding domain specificity:

    • The Δ234-243 deletion targets a sequence unique to GJA1 that is not conserved in other gap junction protein families

    • This domain appears particularly critical for ciliated cell development, as embryos injected with this mutant showed the most notable decrease in ciliated cell numbers

    • All three dominant-negative mutants failed to interact with Rab11a, suggesting multiple domains contribute to this interaction

  • Functional rescue assessment:

    • Comparative rescue experiments with wild-type versus domain-specific mutants

    • Determination of which cellular processes (gap junction formation, trafficking, cytoskeletal organization) correlate with successful ciliary formation

Research indicates that while all tested gja1 mutants disrupt ciliogenesis, the tubulin-binding domain mutant (Δ234-243) produces particularly severe phenotypes regarding ciliated cell numbers . This suggests the tubulin-binding function of gja1 may be especially important for the initial stages of ciliogenesis or ciliary stability.

How can recombinant Danio rerio gja1 be utilized to model human ODDD (Oculodentodigital Dysplasia) in zebrafish?

Oculodentodigital Dysplasia (ODDD) is a human congenital disorder caused by mutations in GJA1 . To model ODDD using recombinant Danio rerio gja1 in zebrafish, researchers should consider these methodological approaches:

  • Disease-relevant mutation introduction:

    • CRISPR/Cas9 gene editing to introduce specific human ODDD mutations into orthologous positions in zebrafish gja1

    • Transgenesis with human ODDD mutant forms of GJA1 to study dominant effects

    • Morpholino knockdown with co-injection of mutant mRNA to create rapid disease models

  • Phenotypic analysis relevant to ODDD:

    • Craniofacial development assessment using alcian blue/alizarin red staining

    • Eye development and function evaluation through microscopy and behavioral assays

    • Limb/fin development analysis

    • Dental structure examination in later-stage fish

  • Molecular and cellular analysis:

    • Gap junction formation assessment in relevant tissues

    • Evaluation of protein trafficking defects using fluorescently tagged mutant proteins

    • Analysis of Rab11-dependent trafficking pathways, which are affected by GJA1 mutations

    • Examination of ciliogenesis in tissues affected in ODDD, given GJA1's role in ciliary formation

  • Therapeutic testing platform:

    • Small molecule screen for compounds that restore proper trafficking of mutant gja1

    • Testing of molecules that enhance gap junction communication

    • Evaluation of approaches targeting downstream affected pathways

Research has demonstrated that beyond gap junction formation, GJA1 has non-channel functions that may contribute to the complex disease phenotypes caused by GJA1 mutations . The interaction with Rab11 and role in ciliogenesis provide mechanistic insights into how GJA1 mutations might lead to developmental abnormalities seen in ODDD.

What advanced experimental designs can detect subtle functional differences between wild-type and mutant forms of recombinant Danio rerio gja1?

To detect subtle functional differences between wild-type and mutant forms of recombinant Danio rerio gja1, researchers should implement these sophisticated experimental approaches:

  • High-resolution functional imaging:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure gap junction dynamics and mobility

    • Ratiometric calcium imaging to assess intercellular calcium wave propagation

    • Super-resolution microscopy to detect nanoscale changes in gap junction plaque organization

  • Electrophysiological techniques:

    • Dual whole-cell patch clamp recording to measure gap junction conductance

    • Microelectrode array (MEA) recordings to assess network-level electrical coupling

    • Electrical coupling strength quantification under various physiological stresses

  • Molecular interaction profiling:

    • Proximity labeling (BioID, APEX) to identify subtle changes in protein interaction networks

    • Förster Resonance Energy Transfer (FRET) to measure direct protein-protein interactions

    • Comparative interactomics using immunoprecipitation followed by mass spectrometry

  • Advanced cellular assays:

    • Single-cell RNA-sequencing to detect transcriptional consequences of subtle gja1 mutations

    • Live-cell trafficking assays with high temporal resolution

    • Quantitative assessment of ciliary trafficking using fluorescence correlation spectroscopy

  • Physiological challenge tests:

    • Response to mechanical stress (measured by mechanosensitive dye uptake)

    • Recovery from hypoxic conditions

    • Cell survival under oxidative stress

Research with dominant-negative mutants has shown that even subtle changes to gja1 function can have profound developmental consequences. For example, the T154A mutation, which mimics closed-channel status without preventing gap junction formation, causes severe defects in cilia formation comparable to complete knockout models . This indicates that sophisticated functional assays beyond simple presence/absence of the protein are essential for understanding mutant phenotypes.

Comparative Analysis Across Model Systems

Translating findings from zebrafish gja1 studies to human disease models presents several methodological challenges that researchers must address:

  • Evolutionary divergence considerations:

    • While zebrafish gja1 shares significant homology with human GJA1, sequence divergence may affect protein-protein interactions

    • Researchers should perform comparative sequence analysis to identify conserved functional domains

    • Domain-swap experiments can determine which regions are functionally interchangeable across species

  • Expression pattern differences:

    • Tissue-specific expression patterns may differ between zebrafish and humans

    • Comprehensive expression profiling using RNA-seq and immunohistochemistry across developmental stages

    • Cell-type specific analysis to identify conserved versus divergent expression patterns

  • Alternative isoform variations:

    • In mammals, GJA1 mRNA produces both full-length Cx43 and a truncated GJA1-20k protein crucial for trafficking

    • Systematic analysis of alternative translation products in zebrafish

    • Functional assessment of potential zebrafish-specific isoforms

  • Physiological context differences:

    • Temperature differences (zebrafish develop at lower temperatures than humans)

    • Different organ architectures (e.g., two-chambered vs. four-chambered heart)

    • Different developmental timelines and environmental factors

  • Technical approaches for translation:

    • Humanized zebrafish models expressing human GJA1 variants

    • Parallel studies in zebrafish and human cell culture systems

    • Validation of key findings in patient-derived cells or tissues

Research on GJA1 in mice has demonstrated the critical importance of the GJA1-20k isoform for proper trafficking and function of gap junctions, with the M213L mutation preventing GJA1-20k production and leading to severe cardiac phenotypes . Whether similar translational regulation occurs in zebrafish remains to be fully characterized, representing an important area for investigation when translating between model systems.

What are the most effective protocols for using recombinant Danio rerio gja1 in structure-function relationship studies?

For rigorous structure-function analysis of recombinant Danio rerio gja1, researchers should follow these methodological approaches:

  • Systematic domain mutation strategy:

    • Alanine-scanning mutagenesis of conserved residues

    • Targeted mutations of known functional domains (channel pore, extracellular loops, tubulin-binding domain)

    • Creation of chimeric constructs swapping domains with other connexins

    • Introduction of disease-associated mutations identified in human GJA1

  • Expression systems for functional analysis:

    • Heterologous expression in gap junction-deficient cell lines

    • Xenopus oocyte expression for electrophysiology

    • In vivo expression in zebrafish gja1 mutants or morphants

    • Reconstitution in lipid bilayers for biophysical studies

  • Functional readouts:

    • Dye transfer assays to measure gap junction permeability

    • Patch clamp to assess channel conductance properties

    • Rab11/Rab8 interaction analysis using co-immunoprecipitation

    • Ciliary formation assessment in gja1-depleted cells/embryos

  • Structural analysis approaches:

    • Cryogenic electron microscopy of purified recombinant protein

    • X-ray crystallography of soluble domains

    • Molecular dynamics simulations informed by experimental data

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

Research has demonstrated that specific domains of gja1 mediate distinct functions. For example, the tubulin-binding domain (amino acids 234-243) appears particularly critical for ciliated cell development , while the T154A mutation affects channel gating without preventing gap junction formation . These domain-specific effects highlight the importance of systematic structure-function analysis.

How can synthetic biology approaches leverage recombinant Danio rerio gja1 for novel applications in developmental biology?

Synthetic biology approaches using recombinant Danio rerio gja1 open exciting possibilities for developmental biology applications:

  • Engineered cellular communication systems:

    • Creation of synthetic gap junction channels with modified conductance or selectivity

    • Orthogonal communication channels for specific cell populations

    • Inducible gap junction systems to control intercellular communication temporally

    • Bifunctional gja1 fusion proteins that couple gap junction communication with additional signaling modalities

  • Optogenetic and chemogenetic control:

    • Light-controlled gja1 channel gating for precise temporal control of cell-cell communication

    • Chemically inducible dimerization systems to regulate gja1 trafficking or function

    • Caged compounds that modify gja1 function upon photoactivation

    • Optogenetic control of Rab11-gja1 interaction to manipulate ciliary development

  • Cellular patterning applications:

    • Engineered gja1 variants with altered permeability to create novel pattern formation systems

    • Manipulation of communication between pigment cell types to generate synthetic patterns

    • Integration with reaction-diffusion systems to test theoretical models of pattern formation

  • Ciliary engineering applications:

    • Manipulation of gja1-Rab11 interactions to control ciliary length or number

    • Engineering gja1 to respond to specific stimuli for inducible ciliogenesis

    • Creation of synthetic organelles based on modified ciliary structures

  • Biosensor development:

    • Integration of fluorescent reporters into gja1 to visualize channel activity

    • Development of split-protein complementation systems based on gja1-protein interactions

    • Creation of tension sensors using gja1 to monitor mechanical forces during development

The dual role of gja1 in gap junction formation and ciliary development through Rab11 interaction provides a unique opportunity to engineer systems that simultaneously control intercellular communication and cellular organization. Such synthetic biology approaches could help dissect the complex relationship between cell-cell communication and developmental patterning in unprecedented ways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.