Recombinant Danio rerio Gap junction gamma-1 protein (gjc1)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Gjc1 channels exhibit distinct biophysical properties compared to vertebrate connexins:

PropertyGjc1 (Cx43.4)Human Cx43C. elegans INX-6
Channel distance (Å)110.1 ± 3.3 77.2 ± 1.1 110.1 ± 3.3
Membrane width (Å)184.1 ± 4.3 162.1 ± 3.1 184.1 ± 4.3
Permeability limit≤10 kDa ≤1 kDa ≤10 kDa

Key functional roles include:

  • Skin patterning: The C-terminus interacts with cytoskeletal proteins to regulate pigment cell distribution in zebrafish .

  • Metabolite exchange: Permits diffusion of molecules up to 10 kDa, such as Texas Red dextran, unlike vertebrate connexins restricted to ≤1 kDa .

  • Electrical coupling: Mediates ion transfer in excitable tissues, though zebrafish-specific roles remain under investigation .

Permeability Assays

Dye transfer experiments in Sf9 cells revealed:

TracerMolecular WeightTransfer Efficiency
Sulforhodamine 101607 Da82.7%
Texas Red dextran3 kDa46.7%
Texas Red dextran10 kDa11.6%

This permeability profile suggests a pore diameter ~1.6 nm, enabling passage of larger molecules than vertebrate connexins .

Applications and Availability

Recombinant gjc1 is commercially produced for:

  • ELISA: Detecting connexin-specific antibodies ($1,736.00/50 µg; ).

  • Functional assays: Studying channel permeability and drug delivery mechanisms .

  • Structural biology: Cryo-EM and X-ray crystallography trials .

Expression systems:

  • E. coli: Cost-effective but lacks post-translational modifications .

  • Yeast: Balances affordability with eukaryotic modifications (e.g., glycosylation) .

  • Mammalian cells: Highest fidelity but limited scalability .

Storage: Stable in Tris-glycerol buffers at -20°C; avoid freeze-thaw cycles .

Future Directions

Current research gaps include:

  • Role of gjc1 in zebrafish development beyond skin patterning.

  • Structural basis for its unique permeability compared to mammalian connexins.

  • Therapeutic potential for enhancing intercellular delivery of macromolecules.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
gjc1; cx43.4; gja7; Gap junction gamma-1 protein; Connexin-43.4; Cx43.4; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
gjc1
Target Protein Sequence
MSWSFLTRLLDEISNHSTFVGKIWLTLFIIFRIVLTVVGGESIYYDEQSKFVCNTQQPGC ENVCYDAFAPLSHVRFWVFQIILITTPTIMYLGFAMHKIARSNDVEYRPVNRKRMPMINR GRNRDYEEAEDNGEEDPMIMEEIVPEKEKAPEKSAVKHDGRRRIKRDGLMKVYILQLLSR IIFEVGFLFGQYILYGFEVAPSYVCTRSPCPHTVDCFVSRPTEKTIFLLIMYAVSCLCLS LTVLEILHLGLSGIRDAFRRRARHQSVQRPRAPICRQVPTAPPGYHTALKKDKLSLGMKP EYNLDSGRESFGDESSSRDIDRLRRHLKLAQQHLDLAYQNGESSPSRSSSPESNGTAVEQ NRLNFAQEKQGSKCEKGIHA
Uniprot No.

Target Background

Function
Gap junctions are structures composed of closely packed pairs of transmembrane channels known as connexons. These channels facilitate the diffusion of low molecular weight materials between adjacent cells. Gap junction gamma-1 protein (gjc1) plays a role in the developmental pathway for notochord and tail formation.
Database Links
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is GJC1 and what is its role in zebrafish cellular communication?

GJC1 (Gap Junction Protein Gamma 1) is a member of the connexin gene family that forms intercellular channels known as gap junctions . In zebrafish, as in other vertebrates, these channels provide a route for the diffusion of low molecular weight materials (less than 1-1.5 kDa) between adjacent cells . Gap junctions formed by GJC1 allow passive diffusion of molecules including:

  • Small ions (K+, Ca2+)

  • Metabolites (glucose)

  • Second messengers (IP3, cAMP)

  • Other small signaling molecules

The protein forms hexameric structures called connexons, which dock with connexons from neighboring cells to create complete intercellular channels. These structures are critical for coordinated tissue function in developmental processes, electrical coupling in excitable tissues, and metabolic cooperation between cells .

How does the structure of Danio rerio GJC1 compare to mammalian orthologs?

Zebrafish GJC1 shares significant structural similarity with mammalian orthologs, particularly in the transmembrane domains and extracellular loops that are critical for channel formation and function. Key structural characteristics include:

While the core channel-forming regions are highly conserved, there are species-specific differences in regulatory domains, particularly in the C-terminal region, which may reflect evolutionary adaptations to different physiological requirements .

What expression patterns does GJC1 exhibit during zebrafish development?

GJC1 exhibits temporally and spatially regulated expression patterns throughout zebrafish development. Though the search results don't provide specific details about GJC1 expression in zebrafish, connexin family members generally show tissue-specific expression patterns that correlate with their functional roles.

Based on studies of connexin gene expression in zebrafish, we can infer that GJC1 likely shows:

  • Early expression during embryogenesis in developing nervous system

  • Presence in cardiac tissue where gap junctional communication is essential

  • Expression in sensory structures, particularly in the retina where gap junction diversity has been documented

  • Potential co-expression with other connexins in specific tissues, allowing for formation of heteromeric or heterotypic channels

Researchers typically investigate expression patterns using in situ hybridization, immunohistochemistry with specific antibodies, and transgenic reporter lines where fluorescent proteins are expressed under the control of the GJC1 promoter.

What basic methods are used to study GJC1 function in zebrafish models?

Several complementary approaches are commonly employed to investigate GJC1 function:

  • Genetic manipulation techniques:

    • Morpholino oligonucleotides for transient knockdown

    • CRISPR/Cas9 gene editing for permanent genetic modification

    • Transgenic overexpression of wild-type or mutant GJC1

  • Functional communication assays:

    • Dye transfer studies using gap junction-permeable fluorescent tracers

    • Scrape-loading techniques to assess intercellular dye movement

    • Lucifer Yellow dye transfer to measure gap junction communication efficiency

  • Protein analysis methods:

    • Western blotting to assess protein expression levels

    • Immunofluorescence to visualize subcellular localization

    • Co-immunoprecipitation to identify protein-protein interactions

  • Physiological measurements:

    • Electrophysiological recording of gap junctional conductance

    • Calcium imaging to assess coordinated cellular responses

    • Functional assays in specific tissues (e.g., cardiac conduction studies)

What phenotypes result from GJC1 dysfunction in zebrafish models?

While the search results don't specify phenotypes directly related to GJC1 disruption in zebrafish, we can infer likely outcomes based on connexin biology and related studies. A study on Cx43 (another connexin family member) in zebrafish provides insights on gap junction dysfunction effects .

Potential phenotypes resulting from GJC1 dysfunction may include:

  • Disrupted electrical coupling in excitable tissues

  • Abnormal cardiac development or function

  • Neurological defects due to impaired communication between neurons

  • Sensory system abnormalities, particularly in visual processing

  • Developmental delays or malformations in tissues dependent on gap junctional communication

The cx43 zebrafish model (lh10) with impaired gap junction endocytosis showed increased connexin expression and elevated gap junctional intercellular communication, demonstrating how alterations in connexin dynamics can affect cellular function .

What are the optimal expression systems and purification strategies for recombinant Danio rerio GJC1?

Production of functional recombinant zebrafish GJC1 requires careful consideration of expression systems and purification strategies:

Expression Systems Comparison:

SystemAdvantagesDisadvantagesYieldRecommended Use
E. coliLow cost, rapidPoor for membrane proteins, lacks PTMsLowInitial construct testing
Insect cells (Sf9)Better folding of membrane proteinsModerate complexity, some PTM differencesModerateStructural studies
Mammalian cells (HEK293)Native-like PTMs, proper foldingHigher cost, slowerLow-ModerateFunctional studies
Cell-free systemsControlled environment, rapidTechnically challengingVariableMechanistic studies

Purification Strategy:

  • Vector design considerations:

    • Addition of affinity tags (His6, FLAG) preferably at the N-terminus

    • Inclusion of cleavable linkers for tag removal

    • Optional fluorescent protein fusion for tracking

    • Codon optimization for the chosen expression system

  • Solubilization protocol:

    • Membrane isolation by differential centrifugation

    • Solubilization using mild detergents (DDM, LMNG)

    • Critical micelle concentration maintenance throughout purification

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC)

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography to isolate hexameric assemblies

  • Functional validation:

    • Circular dichroism to verify secondary structure

    • Reconstitution into liposomes for functional assays

    • Single channel conductance measurements

How can CRISPR/Cas9 technology be optimized for studying GJC1 in zebrafish?

CRISPR/Cas9 technology offers precise genome editing capabilities for GJC1 research. Based on the successful generation of cx43 mutants described in the search results , the following approaches can be applied to GJC1:

Strategic targeting approaches:

  • Knockout strategies:

    • Design gRNAs targeting early exons to create frameshift mutations

    • Multiple gRNA approach to delete entire coding regions

    • Validation by sequencing and protein expression analysis

  • Domain-specific modifications:

    • Precise deletion of functional domains (as demonstrated in the Cx43 Δ256-289 model)

    • Introduction of point mutations at key regulatory residues

    • Creation of phosphorylation-site mutants to study post-translational regulation

  • Reporter knock-ins:

    • Fluorescent protein fusions to study trafficking and localization

    • Addition of epitope tags for biochemical studies

    • Split fluorescent protein complementation for interaction studies

Practical protocol optimization:

ParameterRecommendationRationale
gRNA concentration30 pmol per embryoOptimal for efficient editing
Cas9 protein12 μg per injectionEnsures high activity with minimal toxicity
Delivery methodMicroinjection at one-cell stageEnsures germline transmission
Screening timingInitial at 24 hpf, full at adulthoodBalance between early detection and permanent modifications
Control strategyInclude Cas9-only injectionsControls for potential Cas9 toxicity
Off-target analysisWhole genome sequencing of F2 generationEnsures specificity of observed phenotypes

As demonstrated in the cx43 lh10 transgenic line creation, targeted deletion of specific regulatory domains (amino acids 256-289) successfully modified protein function while maintaining viability .

What experimental approaches can distinguish GJC1-specific functions from other connexins in zebrafish?

Distinguishing GJC1-specific functions from other connexins requires sophisticated experimental approaches:

Genetic strategies:

  • Conditional and tissue-specific manipulation:

    • Cre/loxP systems for spatial and temporal control

    • Heat-shock inducible promoters for temporal control

    • Tissue-specific promoters to restrict manipulation

  • Rescue experiments:

    • Rescue of GJC1 knockout with wild-type or mutant constructs

    • Cross-species complementation to test functional conservation

    • Chimeric connexin constructs to identify domain-specific functions

Functional approaches:

  • Biophysical characterization:

    • Channel conductance measurements to identify GJC1-specific properties

    • Permeability studies using tracers of different sizes and charges

    • Gating response characterization (voltage, pH, calcium sensitivity)

  • Tracer studies with selectivity analysis:

    • Comparative analysis of different gap junction-permeable dyes

    • Metabolite transfer specificity using labeled compounds

    • Microinjection of selected tracers combined with time-lapse imaging

Molecular tools:

  • Specific inhibitors and mimetic peptides:

    • Development of GJC1-specific blocking peptides

    • Antibodies against extracellular domains

    • Dominant negative constructs

  • Interaction mapping:

    • BioID or APEX2 proximity labeling to identify GJC1-specific interactors

    • Comparative interactome analysis between different connexins

    • Yeast two-hybrid screening for differential binding partners

How does phosphorylation regulate GJC1 trafficking and channel gating in zebrafish?

Phosphorylation is a critical regulatory mechanism for connexins. While specific data on zebrafish GJC1 phosphorylation is not provided in the search results, we can extrapolate from the Cx43 studies and general connexin biology:

Key phosphorylation sites and kinases:

Connexins typically contain multiple phosphorylation sites, particularly in the C-terminal domain, that regulate:

  • Channel assembly and trafficking

  • Gap junction plaque formation

  • Channel gating properties

  • Protein-protein interactions

  • Protein half-life and degradation

In the cx43 lh10 zebrafish model, deletion of amino acids 256-289 removed critical MAPK phosphorylation sites (S261, S279, S282), which are involved in channel closure and decreased gap junctional intercellular communication (GJIC) .

Experimental approaches to study phosphorylation:

  • Site-directed mutagenesis:

    • Phosphomimetic mutations (Ser/Thr to Asp/Glu)

    • Phospho-null mutations (Ser/Thr to Ala)

    • Creation of phosphorylation site deletion constructs

  • Phosphorylation-specific detection:

    • Phospho-specific antibodies for western blotting and immunofluorescence

    • Mass spectrometry to identify phosphorylation sites

    • Phos-tag SDS-PAGE to separate phosphorylated forms

  • Kinase inhibition studies:

    • Pharmacological inhibitors of specific kinases (PKA, PKC, MAPK)

    • Genetic manipulation of kinase expression

    • In vitro kinase assays with purified components

Functional consequences of phosphorylation:

Phosphorylation EventEffect on ChannelDetection Method
MAPK phosphorylationChannel closure and decreased GJIC Dye transfer assays, electrophysiology
PKC phosphorylationAltered trafficking dynamicsLive imaging, surface biotinylation
Tyrosine phosphorylationModified protein interactionsCo-immunoprecipitation, FRET
Casein kinase phosphorylationStability regulationPulse-chase, cycloheximide treatment

What methods are most effective for studying GJC1 half-life and turnover in zebrafish models?

Based on the cx43 lh10 study described in the search results , several effective approaches for studying connexin half-life and turnover can be applied to GJC1 research:

In vitro approaches:

  • Cycloheximide chase assays:

    • Treatment of cells expressing GJC1 with cycloheximide to block new protein synthesis

    • Western blot analysis of protein levels over time

    • Quantification of protein decay rates to determine half-life

  • Pulse-chase experiments:

    • Metabolic labeling with radioactive amino acids

    • Immunoprecipitation at different time points

    • Analysis of labeled protein disappearance

  • Surface biotinylation:

    • Selective labeling of surface proteins with membrane-impermeable biotin

    • Monitoring internalization and degradation over time

    • Streptavidin pulldown to isolate labeled proteins

In vivo approaches:

  • Transgenic methods:

    • Photoconvertible fluorescent protein fusions (Dendra2, mEos)

    • Inducible expression systems (Tet-On/Off)

    • Destabilized fluorescent protein reporters

  • Domain-specific mutations:

    • Deletion of endocytosis-regulating domains (as in cx43 lh10)

    • Mutation of ubiquitination sites

    • Disruption of clathrin binding motifs

Analytical techniques:

TechniqueInformation ProvidedAdvantagesLimitations
Western blottingTotal protein levelsQuantitative, simpleNo spatial information
ImmunofluorescenceSpatial distributionVisualizes localizationLess quantitative
FRAPDynamic exchange at gap junctionsReal-time kineticsTechnical complexity
Live imagingTrafficking pathwaysCaptures dynamic eventsRequires specialized equipment

The cx43 lh10 zebrafish model demonstrated that deletion of specific regulatory domains (amino acids 256-289) significantly increased protein half-life due to impaired endocytosis, resulting in enhanced gap junctional communication .

How can gap junction channel properties of recombinant Danio rerio GJC1 be functionally characterized?

Comprehensive functional characterization of GJC1 channels requires multiple complementary approaches:

Electrophysiological methods:

  • Dual whole-cell patch clamp:

    • Recording from cell pairs expressing GJC1

    • Measurement of macroscopic junctional conductance

    • Analysis of voltage-gating properties

    • Chemical gating studies (pH, calcium sensitivity)

  • Single channel recordings:

    • Analysis of unitary conductance

    • Channel open probability determination

    • Dwell time analysis

    • Subconductance state identification

Permeability studies:

Structural approaches:

  • Mutagenesis studies:

    • Pore-lining residue modifications

    • Gating domain alterations

    • Interaction interface mutations

  • Computational modeling:

    • Homology modeling based on available connexin structures

    • Molecular dynamics simulations

    • In silico docking of permeants

As demonstrated in the cx43 lh10 study, functional characterization using Lucifer Yellow transfer revealed that deletion of regulatory domains resulted in significantly increased dye transfer compared to wild-type Cx43, indicating enhanced gap junctional intercellular communication .

What are the most advanced imaging techniques for visualizing GJC1 trafficking and gap junction dynamics?

State-of-the-art imaging approaches for GJC1 visualization include:

Super-resolution microscopy:

  • Stimulated Emission Depletion (STED) microscopy:

    • Resolution down to ~50 nm for detailed plaque architecture

    • Compatible with live-cell imaging for dynamic studies

    • Multi-color capabilities for co-localization studies

  • Single Molecule Localization Microscopy (PALM/STORM):

    • Nanoscale resolution (~20 nm) for single-protein tracking

    • Quantitative analysis of protein clustering

    • Compatible with multi-color imaging for interaction studies

  • Structured Illumination Microscopy (SIM):

    • Doubled resolution compared to conventional microscopy

    • Faster acquisition for dynamic processes

    • Less phototoxicity than other super-resolution techniques

Dynamic imaging approaches:

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Measures lateral mobility within gap junction plaques

    • Quantifies exchange rates between junctional and non-junctional pools

    • Provides information on mobile fraction and diffusion coefficients

  • Fluorescence Loss In Photobleaching (FLIP):

    • Continuous bleaching to measure connectivity between compartments

    • Analysis of long-range communication through gap junction networks

    • Complementary to FRAP for comprehensive dynamics studies

  • Photoactivation and photoconversion:

    • Pulse-chase experiments with optical highlighting

    • Tracking specific protein populations over time

    • Quantitative analysis of protein turnover

Advanced labeling strategies:

  • Genetic tags:

    • Split fluorescent proteins to visualize GJC1-GJC1 interactions

    • Self-labeling protein tags (SNAP, Halo, CLIP) for pulse-chase studies

    • pH-sensitive fluorescent proteins to distinguish surface from internal pools

  • Correlative microscopy:

    • Correlative Light and Electron Microscopy (CLEM) for structural context

    • Combined fluorescence and atomic force microscopy

    • Integrated optical and electrical recording

The cx43 lh10 study demonstrated that gap junction plaque size can be quantified using immunofluorescence and confocal microscopy to assess the effects of mutations on gap junction formation .

How does GJC1 interact with the cytoskeleton and other regulatory proteins in zebrafish?

Understanding GJC1's interactions with the cytoskeleton and regulatory proteins requires comprehensive protein interaction studies:

Cytoskeletal interactions:

Connexins typically interact with multiple cytoskeletal elements that regulate:

  • Trafficking to the membrane

  • Stabilization of gap junction plaques

  • Internalization and degradation

  • Spatial organization within the cell

Regulatory protein interactions:

  • Scaffolding proteins:

    • ZO-1 and other PDZ domain-containing proteins

    • Adherens junction components

    • Tight junction proteins

  • Trafficking machinery:

    • Clathrin and adaptor proteins for endocytosis

    • Microtubule motors for transport

    • Vesicle fusion machinery (SNARE proteins)

  • Degradation pathway components:

    • Ubiquitin ligases (like Nedd4)

    • Autophagy-related proteins

    • Lysosomal targeting factors

Experimental approaches:

TechniqueApplicationInformation Provided
Co-immunoprecipitationProtein-protein interactionsPhysical association
Proximity labeling (BioID, APEX)Identification of interaction neighborhoodSpatial proximity in cells
Yeast two-hybridBinary interactionsDirect binding partners
FRET/FLIMProtein interactions in live cellsReal-time dynamics and spatial information
Pulldown assaysDomain-specific interactionsBinding regions

The cx43 lh10 zebrafish model revealed the importance of specific C-terminal domains (amino acids 256-289) in endocytosis, which contain binding sites for key regulatory proteins including:

  • MAPK phosphorylation sites (S261, S279, S282)

  • Ubiquitination site (K264)

  • Nedd4 E3-ubiquitin ligase binding site

  • AP2/clathrin binding site (S2)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.