Recombinant Danio rerio Germ cell-specific gene 1-like protein (gsg1l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
gsg1l; zgc:114039; Germ cell-specific gene 1-like protein; GSG1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
gsg1l
Target Protein Sequence
MKTTRKCRALLSVGLNLLALLFSTTAFITTYWCEGTQRVPKPNCSKDRRHNCIDYGVNET DPSKVHYSWETGDDRFLFRHFHTGIWYSCEENIHGGGEKCRSFIDLAPASERGVLWLSVV SEVLYIMLLVVGFSLMCLELFHSSNVIDGLKLNAFAAVFTVLSGLLGMVAHMMYTQVFQI TVSLGPEDWRPHTWDYGWSFCMAWGSFTCCMAASVTTLNSYTKTVIEFRHKRKLFEQGLR EEQTFLDPETFHYFRDRSVQSISSSVDVYPSHGSSHGNSRGKMRSPPAPVDQGDNTESLG EEQC
Uniprot No.

Target Background

Function
As a constituent of the AMPAR complex, this protein modifies AMPA receptor (AMPAR) gating.
Database Links
Protein Families
GSG1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse.

Q&A

What is GSG1L protein and what is its basic structure?

GSG1L (Germ cell-specific gene 1-like protein) is a 304-amino acid protein found in Danio rerio (zebrafish) that functions as an auxiliary subunit of AMPA-type glutamate receptors. The protein contains a full-length sequence beginning with MKTTRKCRALLSVGLNLLALLFSTT and ending with NTESLGEEQC . GSG1L is a transmembrane protein that belongs to the family of AMPAR regulatory proteins but has distinct functional properties compared to other members of this family. Unlike the prototypical auxiliary subunit stargazin which enhances receptor function, GSG1L has been identified as having suppressive effects on AMPA receptor signaling . The protein's structure enables it to associate with AMPA receptors and modify their functional properties in ways that affect synaptic transmission.

How does GSG1L differ functionally from other AMPA receptor auxiliary subunits?

GSG1L exhibits a unique functional profile that distinguishes it from other AMPA receptor auxiliary subunits such as stargazin. While most auxiliary subunits enhance AMPAR function, GSG1L has a predominantly inhibitory role:

  • GSG1L reduces the weighted mean single-channel conductance of calcium-permeable AMPARs, whereas stargazin increases it .

  • GSG1L decreases calcium permeability of AMPARs, in contrast to stargazin which enhances it .

  • GSG1L dramatically delays recovery from desensitization by over a magnitude compared to other auxiliary subunits .

  • GSG1L increases polyamine-dependent rectification, while stargazin relieves the voltage-dependent block by endogenous intracellular polyamines .

These functional differences suggest GSG1L plays a specialized role in negatively regulating AMPAR function, particularly in specific brain regions where it is enriched, such as the anterodorsal and anteroventral nuclei of the anterior thalamus .

What are the optimal conditions for recombinant expression of Danio rerio GSG1L?

For optimal recombinant expression of Danio rerio GSG1L, the following protocol has proven effective:

  • Expression System: E. coli is the preferred host for full-length GSG1L expression (amino acids 1-304) .

  • Tagging Strategy: N-terminal His-tagging facilitates purification while maintaining protein functionality .

  • Expression Construct: The full coding sequence should be codon-optimized for E. coli expression.

  • Induction Conditions: Optimal expression is typically achieved using IPTG induction at lower temperatures (16-18°C) overnight to reduce inclusion body formation.

  • Cell Lysis: Mechanical disruption in a Tris-based buffer with protease inhibitors is recommended.

The resulting protein can be obtained with greater than 90% purity as determined by SDS-PAGE analysis . This approach yields functional protein suitable for biochemical and structural studies of GSG1L.

What storage and reconstitution methods preserve GSG1L activity?

To maintain optimal activity of recombinant GSG1L protein:

Storage Conditions:

  • Store the lyophilized powder at -20°C/-80°C upon receipt .

  • For long-term storage, reconstituted protein should be supplemented with 5-50% glycerol (with 50% being optimal) and stored at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

  • Working aliquots can be stored at 4°C for up to one week .

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom before opening.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • The recommended storage buffer is a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided through proper aliquoting . Following these handling protocols ensures maintained structural integrity and functional properties of the recombinant GSG1L protein for experimental applications.

How can GSG1L be used to study synaptic plasticity mechanisms?

GSG1L offers unique opportunities for investigating synaptic plasticity mechanisms due to its distinctive effects on AMPA receptor function. Research approaches include:

  • Short-Term Plasticity Studies: GSG1L regulates short-term plasticity specifically at corticothalamic (C-T) synapses but not at mammillothalamic or subicular-thalamic synapses . This pathway-specific regulation can be leveraged to study synaptic input specificity by:

    • Comparing wild-type and GSG1L knockout models during different stimulation protocols

    • Using electrophysiological recordings to measure synaptic responses during repetitive stimulation

    • Examining how GSG1L affects the conversion between short-term depression and facilitation

  • Receptor Recovery Kinetics Analysis: Since GSG1L dramatically slows AMPAR recovery from desensitization, researchers can use GSG1L manipulation to isolate the contribution of receptor recovery kinetics to synaptic function through:

    • Fast-application patch-clamp recordings comparing wild-type and GSG1L-deficient neurons

    • Paired-pulse protocols with varying interstimulus intervals to quantify recovery time courses

  • Calcium Permeability Regulation: GSG1L reduces calcium permeability of calcium-permeable AMPARs , providing a tool to study calcium-dependent plasticity mechanisms by:

    • Using calcium imaging combined with GSG1L overexpression or knockdown

    • Measuring calcium-dependent signaling cascades in neurons with modified GSG1L expression

These approaches can reveal fundamental principles about how auxiliary proteins fine-tune synaptic transmission and plasticity in a pathway-specific manner, with potential implications for understanding learning and memory mechanisms.

What role does GSG1L play in neurological disorders, based on current research?

Based on current research, GSG1L has important implications for neurological disorders, particularly those involving hyperexcitability and seizures:

  • Seizure Susceptibility: GSG1L knockout mice demonstrate increased susceptibility to seizures, consistent with its negative regulatory role in synaptic transmission . This suggests GSG1L may function as an endogenous inhibitor that helps maintain optimal excitation levels in specific brain circuits. The anterior thalamus, where GSG1L is enriched, is critically involved in seizure initiation and propagation .

  • Hyperexcitability Disorders: GSG1L's ability to suppress AMPAR function through reduced channel conductance and calcium permeability positions it as a potential target for conditions characterized by neuronal hyperexcitability. When GSG1L is absent, neurons exhibit hyperexcitability , which could contribute to epileptogenesis or excitotoxicity.

  • Memory and Navigation Disorders: Given that GSG1L is enriched in the anterior thalamus, which is crucial for memory formation and spatial navigation , abnormal GSG1L function might contribute to disorders affecting these cognitive domains. The anterior thalamus processes head direction information during spatial navigation and is important for memory formation .

Research approaches might include correlating GSG1L expression levels or functional variants with seizure susceptibility in clinical populations, or investigating potential GSG1L-targeting therapeutics for epilepsy management.

How can one design electrophysiological experiments to study GSG1L's effects on AMPA receptor function?

To effectively study GSG1L's effects on AMPA receptor function through electrophysiology, consider the following experimental design approaches:

Recombinant System Studies:

  • Co-expression Systems: Design experiments expressing AMPARs with and without GSG1L in heterologous expression systems (HEK293 cells or Xenopus oocytes) to isolate direct effects on receptor function .

  • Single-Channel Recording: Utilize outside-out patch-clamp recordings with fast glutamate application to measure:

    • Weighted mean single-channel conductance (expected to decrease with GSG1L)

    • Desensitization and recovery kinetics (GSG1L significantly delays recovery)

    • Rectification properties (GSG1L increases polyamine-dependent rectification)

Neuronal Studies:

  • Pathway-Specific Analysis: Design stimulation protocols targeting specific inputs to anterior thalamic neurons:

    • Use sagittal sections to record from mammillothalamic and subiculum-thalamic synapses

    • Use coronal sections to access corticothalamic synapses

    • Apply paired-pulse or train stimulation (20-50 Hz) to assess short-term plasticity differences

  • Genetic Manipulation Approaches:

    • Compare GSG1L knockout mice with wild-type controls

    • Use shRNA for acute knockdown in culture systems

    • Employ overexpression studies in neurons that normally express low levels of GSG1L

  • Analysis Parameters:

    • Measure rectification index (RI) calculated as the ratio of EPSC amplitude at positive and negative holding potentials

    • Calculate paired-pulse ratio (PPR) to quantify short-term plasticity

    • Analyze miniature EPSC amplitude distributions to detect subpopulations of affected synapses

This experimental approach allows for comprehensive characterization of GSG1L's unique regulatory effects on AMPA receptor function at both molecular and synaptic levels.

What methods can be used to study the interaction between GSG1L and AMPA receptors?

To investigate the molecular interactions between GSG1L and AMPA receptors, researchers can employ the following methodological approaches:

Biochemical Interaction Methods:

  • Co-immunoprecipitation (Co-IP): Use antibodies against GSG1L or AMPAR subunits to pull down protein complexes from brain tissue or transfected cells, followed by Western blot analysis to confirm interaction.

  • Proximity Ligation Assay (PLA): This technique can visualize protein-protein interactions within intact cells or tissue sections with nanometer resolution, allowing detection of GSG1L-AMPAR complexes in their native context.

  • Tandem Affinity Purification (TAP): Using tagged GSG1L expressed in recombinant systems or transgenic animals to isolate protein complexes under native conditions.

Structural Biology Approaches:

  • Cryo-Electron Microscopy: This has been successfully used to determine structures of AMPAR complexes with other auxiliary subunits and could reveal how GSG1L integration modifies receptor structure.

  • Cross-linking Mass Spectrometry: Identifies interaction interfaces by cross-linking proteins in close proximity followed by mass spectrometric analysis.

Functional Interaction Studies:

  • Domain Mapping: Generate truncation or chimeric constructs between GSG1L and other auxiliary subunits (like stargazin) to identify domains responsible for its unique inhibitory effects on AMPAR function.

  • Site-Directed Mutagenesis: Introduce point mutations in key residues of GSG1L to disrupt specific interactions with AMPARs and measure functional consequences using electrophysiology.

  • FRET/FLIM Analysis: Monitor real-time interactions between fluorescently-tagged GSG1L and AMPAR subunits to study the dynamics of complex formation.

These complementary approaches provide a comprehensive toolkit for understanding the molecular basis of GSG1L's unique functional effects on AMPA receptors, potentially revealing novel regulatory mechanisms of synaptic transmission.

What are common challenges in working with recombinant GSG1L and how can they be addressed?

Researchers working with recombinant GSG1L protein may encounter several challenges. Here are the most common issues and their solutions:

Protein Solubility Issues:

  • Challenge: As a transmembrane protein, GSG1L can exhibit poor solubility during expression and purification.
    Solution: Optimize buffer conditions by including mild detergents (0.1% DDM or 0.5% CHAPS) or use fusion tags that enhance solubility (such as MBP or SUMO) in addition to the His-tag .

Protein Stability Concerns:

  • Challenge: Recombinant GSG1L may show rapid degradation during storage.
    Solution: Store in buffer containing 50% glycerol at -80°C and add protease inhibitors during all handling steps . The inclusion of 6% trehalose in storage buffer has been shown to enhance stability .

Functional Activity Verification:

  • Challenge: Confirming that recombinant GSG1L retains its native functional properties.
    Solution: Validate activity through co-expression with AMPA receptors in heterologous systems followed by electrophysiological recording to verify its characteristic effects on receptor desensitization and conductance .

Specificity in Interaction Studies:

  • Challenge: Ensuring observed interactions are specific and physiologically relevant.
    Solution: Include appropriate controls such as GSG1L mutants lacking key domains and compare interactions with different AMPAR subunit combinations.

Expression Level Optimization:

  • Challenge: Achieving sufficient expression levels in E. coli.
    Solution: Lower induction temperature (16°C), use specialized E. coli strains designed for membrane protein expression (C41/C43), and optimize codon usage for bacterial expression .

By anticipating these challenges and implementing the suggested solutions, researchers can significantly improve their success in working with recombinant GSG1L protein for various experimental applications.

How should researchers interpret contradictory data regarding GSG1L function in different experimental systems?

When faced with contradictory data regarding GSG1L function across different experimental systems, researchers should consider several factors for proper interpretation:

Context-Dependent Effects:

  • Synapse Specificity: GSG1L's effects are pathway-specific, modulating short-term plasticity in corticothalamic synapses but not in mammillothalamic or subicular-thalamic connections . Contradictory results may reflect this inherent input specificity rather than experimental artifacts.

  • Expression Level Variations: Even within GSG1L knockout studies, only a subset of neurons show significant effects on mEPSC amplitude , suggesting threshold effects or compensatory mechanisms that depend on expression levels.

Methodological Considerations:

  • Preparation Differences: Compare the preparation types (recombinant systems vs. acute slices vs. cultured neurons) as GSG1L may function differently in these contexts.

  • Analysis Approach: Examine whether contradictions arise from different analytical methods. For example:

    • Population averaging may mask effects present in only a subset of synapses

    • Single-time-point measurements might miss dynamic effects revealed in time-course studies

Experimental Interpretation Framework:

Experimental SystemExpected GSG1L EffectCommon ContradictionsResolution Approach
Heterologous expressionDecreased AMPAR conductance & Ca²⁺ permeabilityEnhanced current in some subunit combinationsVerify subunit composition and auxiliary protein profile
Acute brain slicesPathway-specific regulation of short-term plasticityNo effect on basal transmissionFocus analysis on specific input pathways and use repetitive stimulation protocols
Cultured neuronsIncreased rectification of AMPARs upon overexpressionVariable effects on mEPSC amplitudeExamine cell-type specificity and developmental stage

Integration Strategies:

  • Conduct parallel experiments in multiple systems with identical reagents

  • Perform dose-response studies to detect threshold effects

  • Consider the presence of other auxiliary subunits that might interact with GSG1L

By carefully examining experimental conditions and embracing the complexity of GSG1L's context-dependent functions, researchers can resolve apparent contradictions and develop a more nuanced understanding of this unique auxiliary subunit's role in synaptic physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.