Recombinant Danio rerio Glucose-6-phosphatase 3 (g6pc3)

Shipped with Ice Packs
In Stock

Description

Enzymatic and Metabolic Roles

G6PC3 in zebrafish mirrors its human homolog’s role in glucose homeostasis but lacks the severe congenital neutropenia phenotype seen in humans . Key findings:

  • Substrate Hydrolysis: Catalyzes G6P → glucose + phosphate with a pH optimum of 6.5–7.0 .

  • Metabolic Linkages: Forms a complex with G6P transporters (e.g., SLC37A4) to regulate glycogenolysis and gluconeogenesis .

  • Deficiency Effects: Zebrafish models show altered neutrophil glycosylation and ER stress, mimicking human G6PC3-associated metabolic disorders .

Table 2: Catalytic Activity Comparison

SubstrateRelative Activity (%)Notes
Glucose-6-phosphate (G6P)100Primary substrate
Mannose-6-phosphate (M6P)~95Stereoisomer of G6P
Fructose-6-phosphate (F6P)~30Lower affinity
ATP<5Non-physiological substrate

Research Applications

Recombinant Danio rerio G6PC3 is widely used in:

  • Enzyme-Linked Immunosorbent Assays (ELISA): Quantify protein levels in metabolic studies .

  • Western Blotting: Detect endogenous G6PC3 expression in zebrafish tissues .

  • Functional Studies: Investigate ER stress, neutrophil dysfunction, and glycosylation defects .

Production and Purification

  • Expression Systems: Optimized in E. coli and insect cells (e.g., Sf9) for high-yield soluble protein .

  • Detergent Solubilization: Lauryl maltose neopentyl glycol (LMNG) preserves enzymatic activity during ER membrane extraction .

  • Storage: Stable at -80°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw cycles .

Comparative Analysis with Mammalian Homologs

Zebrafish G6PC3 shares ~60% sequence identity with human G6PC3 but lacks associations with neutropenia. Key differences:

  • Glycosylation Defects: Human G6PC3 mutations disrupt neutrophil N- and O-glycosylation, while zebrafish models show milder phenotypes .

  • Inflammasome Activation: Impaired glycolysis in human G6PC3-deficient neutrophils increases NLRP3 inflammasome activity, a pathway less pronounced in zebrafish .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
In general, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
g6pc3; zgc:158425; Glucose-6-phosphatase 3; G-6-Pase 3; G6Pase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MESLYRQGVWMAEALQQNSRSLEDLWLVASHMGDPKAAVLLVFPVVFYIHRRTGIAVLWV AALSEWLNLVFKWILFGERPYWWIGQSGLFSEKPPEVQQFQSTCESGPGSPSGHAMVTSA VWWVIISSLASFSQAYTGSKILSAVLYLLYAVFLGCVGLSRIFILAHFPHQVVAGLLTGV LLGVFLKRSVPERRPLLFFFRFSMALLGAALIFHAVLEKTGIDLSWSISLAKRWCSRSEW VRMDTAPFSSLNRDAGVLLGLGLAQYWKPGGWTLPRAPRTLCLALSSLALHYISRFPLPT VPPLLFYSLFFLKYSIVPQVVMVLVPGFVHLLTAKPKRE
Uniprot No.

Target Background

Function
This protein hydrolyzes glucose-6-phosphate to glucose within the endoplasmic reticulum. It may play a crucial role in glucose production through glycogenolysis and gluconeogenesis.
Database Links
Protein Families
Glucose-6-phosphatase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Glucose-6-phosphatase 3 (g6pc3) in Danio rerio?

Glucose-6-phosphatase 3 (g6pc3) in Danio rerio (zebrafish) is an enzyme that catalyzes the hydrolysis of glucose-6-phosphate (G6P) to glucose and phosphate. It is the zebrafish ortholog of human G6PC3, which is embedded in the endoplasmic reticulum (ER) membrane. The protein is also known by alternative nomenclature including G-6-Pase 3 or G6Pase 3, with the Enzyme Commission (EC) number 3.1.3.9. The full-length protein consists of 339 amino acids and is encoded by the g6pc3 gene (also known by the ORF name zgc:158425) . G6pc3 plays a crucial role in glucose homeostasis and neutrophil function, making it an important subject for research in both developmental biology and disease modeling.

What is the biochemical function of g6pc3 in zebrafish?

The primary biochemical function of g6pc3 in zebrafish is to catalyze the final step of glycogenolysis and gluconeogenesis by hydrolyzing glucose-6-phosphate to glucose and inorganic phosphate. This enzymatic activity is critical for maintaining glucose homeostasis, particularly during periods of fasting or increased energy demand. In zebrafish, as in humans, g6pc3 functions within the endoplasmic reticulum membrane where it works in concert with glucose-6-phosphate transporter (G6PT) to regulate glucose release from cells .

The enzyme plays a particularly important role in neutrophil function and survival. Deficiency in g6pc3 can lead to increased endoplasmic reticulum stress, which may trigger apoptosis of neutrophils. This connection between glucose metabolism and neutrophil function makes g6pc3 an important target for studying immune system development and function in zebrafish . Additionally, under oxygen-limited conditions, the expression of glucose-6-phosphatase genes may be altered as part of metabolic adaptation mechanisms, suggesting a role in the response to environmental stressors .

How is the g6pc3 gene organized in Danio rerio compared to humans?

The g6pc3 gene in Danio rerio, like its human counterpart, is a single-copy gene. While the human G6PC3 gene is located on chromosome 17q21 and consists of 6 exons, the zebrafish ortholog maintains a similar genomic organization . The zebrafish g6pc3 gene shows considerable conservation in its exon-intron structure compared to the human gene, reflecting the evolutionary conservation of this important metabolic enzyme.

Key comparative features include:

  • Zebrafish g6pc3 gene is expressed as the ORF zgc:158425

  • The coding region spans positions 1-339 of the protein

  • The gene shares significant sequence homology with human G6PC3, particularly in catalytic domains and transmembrane regions

  • Conserved exon-intron boundaries suggest similar splicing regulation mechanisms

This high degree of conservation between zebrafish and human g6pc3 genes makes the zebrafish an excellent model organism for studying g6pc3 function and related human diseases such as severe congenital neutropenia due to G6PC3 deficiency.

How can I assess the enzymatic activity of recombinant Danio rerio g6pc3?

Assessing the enzymatic activity of recombinant Danio rerio g6pc3 requires sensitive and reliable methods due to the membrane-bound nature of the protein and its relatively low activity levels. The most effective approach involves a recombinant adenoviral (rAd) vector-mediated expression system, which significantly enhances the sensitivity of phosphohydrolase activity assays .

Methodological protocol:

  • Express recombinant g6pc3 in a suitable system:

    • Construct rAd vectors carrying wild-type or mutant g6pc3 using Cre-lox recombination

    • Infect appropriate cell lines (such as COS-7 cells) with the rAd vectors

    • Allow 48-72 hours for protein expression

  • Prepare microsomes for activity assay:

    • Harvest and homogenize cells in a buffer containing protease inhibitors

    • Isolate microsomal fractions through differential centrifugation

    • Quantify protein concentration using standard methods (e.g., Bradford assay)

  • Perform phosphohydrolase activity assay:

    • Incubate microsomes with glucose-6-phosphate substrate

    • Measure the release of inorganic phosphate using colorimetric methods

    • Calculate specific activity in nmol/min/mg protein

    • Include appropriate controls (e.g., microsomes from cells expressing empty vector)

  • Data analysis:

    • Compare the activity of wild-type versus mutant g6pc3

    • Normalize results to protein expression levels determined by Western blotting

    • Determine kinetic parameters (Km, Vmax) for comprehensive enzymatic characterization

This rAd vector-mediated expression system offers significant advantages over previous yeast-based or lymphoblastoid cell line assays, as it provides higher expression levels and lower background phosphatase activity, making it ideal for characterizing mutations with potentially low residual activity .

What expression systems are optimal for producing functional recombinant Danio rerio g6pc3?

Producing functional recombinant Danio rerio g6pc3 presents challenges due to its nature as a multi-pass transmembrane protein with complex folding requirements. Several expression systems have been evaluated, with varying degrees of success:

1. Mammalian cell expression systems:

  • Recombinant adenoviral (rAd) vector system: This is the preferred method for functional studies, yielding high expression levels with proper post-translational modifications and membrane insertion. The system provides G6Pase-β activity of approximately 107.5 ± 5.1 nmol/min/mg with low background activity (only 7.4% of wild-type activity) .

  • Transient transfection of mammalian cells: Using expression vectors with strong promoters (CMV, EF1α) in HEK293 or COS-7 cells can produce functional protein, though at lower levels than rAd systems.

2. Insect cell expression systems:

  • Baculovirus-infected Sf9 or Hi5 cells can express functional membrane proteins, though glycosylation patterns differ from vertebrate systems.

3. Cell-free expression systems:

  • Recent advances in cell-free systems supplemented with microsomes or nanodiscs show promise for expressing functional membrane proteins but may require optimization for g6pc3.

Factors critical for functional expression:

  • Inclusion of appropriate signal sequences for ER targeting

  • Maintenance of optimal redox conditions for proper disulfide bond formation

  • Addition of molecular chaperones to facilitate correct folding

  • Careful solubilization and purification using mild detergents to maintain activity

The recombinant adenoviral vector system remains the gold standard for functional studies, while other systems may be appropriate depending on the specific research application and required protein yield.

How do mutations in Danio rerio g6pc3 affect protein function and stability?

Mutations in Danio rerio g6pc3 can significantly impact protein function and stability, paralleling observations in human G6PC3. Functional analysis of g6pc3 mutations provides valuable insights into structure-function relationships and disease mechanisms. Based on analogous studies of human G6PC3 mutations, several patterns emerge:

Effects on enzymatic activity:

  • Mutations can completely abolish enzymatic activity (null mutations) or result in partial retention of function

  • In human G6PC3, 14 out of 16 characterized missense mutations completely abolished enzyme activity, while p.S139I and p.R189Q mutations retained 49% and 45% of wild-type activity, respectively

  • Mutations in transmembrane helices typically have more severe effects than those in cytoplasmic loops

Effects on protein stability and localization:

  • Many mutations affect protein folding and stability, leading to ER retention and degradation

  • Mutations in conserved residues often disrupt the catalytic site or substrate binding

  • Alterations in transmembrane domains can disrupt membrane integration and protein topology

Molecular mechanisms of dysfunction:

  • Catalytic site disruption: Mutations in residues directly involved in G6P hydrolysis

  • Structural destabilization: Mutations causing protein misfolding and premature degradation

  • Membrane integration defects: Mutations altering transmembrane domain properties

  • Substrate binding impairment: Mutations affecting G6P recognition and binding

The transmembrane topology of g6pc3, with its 9 helices (H1-H9) and 4 cytoplasmic loops (C1-C4), provides a structural framework for understanding mutation effects. Mutations in helical regions (e.g., H3, H4, H5, H6, H7) tend to have more severe consequences than those in cytoplasmic loops (e.g., C1, C2, C3) . This pattern underscores the critical importance of membrane integration for g6pc3 function.

What are the differences between zebrafish g6pc3 and human G6PC3?

While zebrafish g6pc3 and human G6PC3 share significant functional and structural similarities, several key differences exist that researchers should consider:

Sequence homology and conservation:

  • Zebrafish g6pc3 and human G6PC3 share approximately 70-75% amino acid identity

  • Catalytic residues and transmembrane domains show higher conservation than loop regions

  • The nine-transmembrane helix structure is preserved between species

Functional differences:

  • Subtle differences in substrate specificity and kinetic parameters may exist

  • Temperature optima differ, reflecting the physiological temperature ranges of each species

  • Potential differences in regulatory mechanisms and post-translational modifications

Expression patterns:

  • Tissue-specific expression patterns may vary between zebrafish and humans

  • Developmental regulation of g6pc3 expression may follow different timelines

  • Response to physiological stimuli (feeding, fasting, stress) may show species-specific patterns

Protein interactions:

  • Differences in protein-protein interaction networks may exist

  • Species-specific adaptor proteins or regulatory factors may influence function

  • Membrane microdomain localization may vary between human and zebrafish orthologs

These differences highlight the importance of species-specific characterization when using zebrafish as a model for human G6PC3-related diseases. Despite these differences, the high degree of conservation makes zebrafish g6pc3 a valuable model for understanding fundamental aspects of G6PC3 function and providing insights into human disease mechanisms.

What are the optimal conditions for storing and handling recombinant Danio rerio g6pc3?

Proper storage and handling of recombinant Danio rerio g6pc3 are critical for maintaining protein stability and enzymatic activity. Based on experimental protocols for similar proteins, the following guidelines are recommended:

Storage conditions:

  • Store the protein at -20°C for routine use

  • For extended storage, maintain at -80°C to prevent degradation

  • Use a stabilizing buffer containing Tris-based components with 50% glycerol

  • Avoid repeated freeze-thaw cycles which can significantly reduce activity

Handling recommendations:

  • When working with the protein, keep samples on ice or at 4°C

  • Working aliquots can be stored at 4°C for up to one week to avoid freeze-thaw cycles

  • Use low-binding microcentrifuge tubes to prevent protein adsorption

  • Include protease inhibitors in working solutions to prevent degradation

Buffer composition:

  • Optimal buffer: Tris-HCl (pH 7.2-7.4) with 50% glycerol

  • For activity assays, use buffers containing divalent cations (Mg²⁺, Mn²⁺)

  • Consider adding reducing agents (DTT, β-mercaptoethanol) at low concentrations to maintain thiol groups

  • For membrane-bound forms, include mild detergents or lipid components to maintain native conformation

Quality control measures:

  • Regularly assess protein integrity by SDS-PAGE

  • Monitor enzymatic activity before experiments

  • Check for aggregation using light scattering or size-exclusion chromatography

  • Validate proper folding using circular dichroism or fluorescence spectroscopy

Following these guidelines will help ensure that recombinant Danio rerio g6pc3 maintains optimal activity and stability for experimental applications.

What assays can be used to measure g6pc3 activity in zebrafish models?

Multiple complementary approaches can be employed to measure g6pc3 activity in zebrafish models, each with distinct advantages and limitations:

1. Biochemical assays for enzymatic activity:

  • Phosphohydrolase activity assay: The gold standard for direct measurement of g6pc3 activity involves quantifying inorganic phosphate release from glucose-6-phosphate substrate. This can be performed using:

    • Microsomal fractions isolated from zebrafish tissues

    • Recombinant adenoviral expression systems (high sensitivity, low background)

    • Colorimetric detection methods (malachite green, molybdate-based)

  • Glucose production assay: Measures the complete G6P hydrolysis by quantifying released glucose using enzymatic-coupled reactions with glucose oxidase/peroxidase or hexokinase/G6PDH.

2. Gene expression analysis:

  • qRT-PCR: Quantifies g6pc3 mRNA expression levels in different tissues or under various conditions

  • RNA-seq: Provides comprehensive transcriptomic profiling, revealing g6pc3 expression patterns and co-regulated genes

  • In situ hybridization: Visualizes spatial distribution of g6pc3 expression in zebrafish embryos or tissue sections

3. Protein detection methods:

  • Western blotting: Quantifies g6pc3 protein levels using specific antibodies

  • Immunohistochemistry: Localizes g6pc3 protein in tissue sections

  • Fluorescent protein tagging: Monitors protein expression and localization in live zebrafish using g6pc3-fluorescent protein fusions

4. Functional metabolic assays:

  • Glucose tolerance tests: Assesses whole-organism glucose handling

  • Glycogen content analysis: Measures the impact of g6pc3 function on glycogen storage

  • Neutrophil function assays: Evaluates neutrophil count, survival, and function as indirect indicators of g6pc3 activity

5. CRISPR/Cas9-based g6pc3 mutant zebrafish:

  • Generate knockout or knockin zebrafish lines to study loss-of-function or specific mutations

  • Assess phenotypic consequences and correlation with enzymatic activity

  • Use for high-throughput drug screening or genetic modifier studies

Each method provides complementary information, and combining multiple approaches offers the most comprehensive assessment of g6pc3 function in zebrafish models.

How can I develop zebrafish models for studying g6pc3 deficiency?

Developing zebrafish models for studying g6pc3 deficiency requires a systematic approach to generate, validate, and characterize mutant lines. The following methodology provides a comprehensive framework:

1. Generation of g6pc3-deficient zebrafish:

a) CRISPR/Cas9 genome editing:

  • Design sgRNAs targeting exonic regions of zebrafish g6pc3 gene

  • Inject Cas9 protein and sgRNAs into one-cell stage embryos

  • Screen F0 mosaic founders and establish stable F1 lines

  • Confirm mutations by sequencing and characterize alleles

b) Morpholino knockdown (for transient analysis):

  • Design splice-blocking or translation-blocking morpholinos

  • Validate specificity with rescue experiments

  • Use as complementary approach to genetic mutants

c) Transgenic approaches:

  • Generate tissue-specific g6pc3 knockdown or overexpression lines

  • Create fluorescent reporter lines to monitor g6pc3 expression

  • Develop conditional knockout systems using Cre/lox or similar technology

2. Validation of g6pc3-deficient models:

a) Molecular validation:

  • Confirm reduced/absent g6pc3 mRNA by qRT-PCR

  • Verify protein reduction/absence by Western blotting

  • Measure g6pc3 enzymatic activity in microsomes from mutant fish

b) Phenotypic characterization:

  • Monitor embryonic and larval development

  • Assess neutrophil count, morphology, and function

  • Evaluate glucose homeostasis and glycogen metabolism

  • Examine known hallmarks of human G6PC3 deficiency

3. Advanced characterization and applications:

a) Comprehensive phenotyping:

  • High-content imaging of neutrophil dynamics

  • Metabolomic profiling of g6pc3-deficient fish

  • Infection challenges to assess immune function

  • Stress tests to evaluate metabolic resilience

b) Translational applications:

  • Drug screening for compounds that rescue g6pc3 deficiency

  • Testing gene therapy approaches

  • Modeling specific human G6PC3 mutations

  • Investigating genetic modifiers of disease severity

c) Mechanistic studies:

  • Transcriptomic analysis to identify altered pathways

  • Investigation of ER stress responses

  • Analysis of neutrophil apoptosis mechanisms

  • Assessment of energy metabolism in neutrophils

By following this methodological framework, researchers can develop robust zebrafish models of g6pc3 deficiency that recapitulate key aspects of human disease and provide valuable insights into disease mechanisms and potential therapeutic approaches.

How can zebrafish g6pc3 models contribute to understanding human G6PC3 deficiency?

Zebrafish g6pc3 models offer powerful advantages for understanding human G6PC3 deficiency through multiple complementary approaches:

Genetic and molecular insights:
The high conservation between zebrafish g6pc3 and human G6PC3 enables direct translation of genetic findings. Zebrafish models allow researchers to validate the pathogenicity of novel human G6PC3 variants by introducing equivalent mutations and assessing their impact on enzyme function and physiological outcomes . This is particularly valuable for characterizing variants of uncertain significance identified through clinical whole-exome sequencing .

Neutrophil biology and immune function:
G6PC3 deficiency in humans manifests primarily as severe congenital neutropenia with susceptibility to infections. Zebrafish models enable detailed investigation of neutrophil development, survival, and function. The optical transparency of zebrafish larvae allows real-time visualization of neutrophil dynamics using transgenic lines with fluorescently labeled neutrophils. This approach can reveal how g6pc3 deficiency affects neutrophil apoptosis, chemotaxis, and phagocytic capacity, providing mechanistic insights into the cellular basis of neutropenia in human patients .

Metabolic consequences:
G6PC3 deficiency disrupts glucose homeostasis with downstream metabolic consequences. Zebrafish models facilitate comprehensive metabolic profiling to identify altered pathways and potential compensatory mechanisms. The ability to perform whole-organism studies allows researchers to examine how g6pc3 deficiency affects glucose metabolism across different tissues and developmental stages. This systemic approach can uncover previously unrecognized metabolic aspects of the human condition.

Drug discovery and therapeutic development:
Zebrafish models are ideally suited for high-throughput screening approaches to identify compounds that may rescue g6pc3 deficiency. Their small size, rapid development, and amenability to chemical screening make them valuable tools for discovering potential therapeutic agents. Compounds that improve neutrophil count or function in g6pc3-deficient zebrafish can be prioritized for further investigation in mammalian models and potentially for clinical development.

By integrating findings from zebrafish g6pc3 models with clinical observations, researchers can develop a more comprehensive understanding of human G6PC3 deficiency and identify novel therapeutic approaches for this rare but severe disorder.

What are the phenotypic characteristics of g6pc3 deficiency in zebrafish?

Based on studies of g6pc3-deficient zebrafish models and knowledge of human G6PC3 deficiency, the following phenotypic characteristics would be expected in zebrafish models:

Hematological abnormalities:

  • Reduced neutrophil counts (neutropenia), which may show cyclical patterns

  • Increased neutrophil apoptosis due to enhanced endoplasmic reticulum stress

  • Altered neutrophil morphology and impaired neutrophil migration

  • Compromised response to infectious challenges and wound healing

Metabolic disturbances:

  • Altered glucose homeostasis, particularly during fasting periods

  • Changes in glycogen storage in liver and muscle tissues

  • Modified expression of genes involved in gluconeogenesis and glycolysis

  • Potential compensatory upregulation of other glucose-metabolizing enzymes

Developmental effects:

  • Potential developmental delays or defects, particularly in tissues with high g6pc3 expression

  • Possible cardiovascular abnormalities (analogous to those seen in some human patients)

  • Altered stress responses during embryonic and larval development

Cellular and molecular phenotypes:

  • Increased markers of endoplasmic reticulum stress in neutrophils and other tissues

  • Enhanced apoptosis in tissues expressing high levels of g6pc3

  • Ultrastructural abnormalities in neutrophils and potentially other cell types

  • Dysregulated glucose-sensing pathways and altered insulin responsiveness

Immune function:

  • Increased susceptibility to bacterial infections

  • Impaired inflammatory responses

  • Delayed resolution of inflammation

  • Potential compensatory changes in other immune cell populations

The phenotypic characteristics may vary depending on the nature of the genetic modification (complete knockout vs. specific mutations) and may be influenced by genetic background and environmental factors. Careful phenotypic characterization across multiple domains is essential for establishing zebrafish g6pc3 models that accurately recapitulate human disease features.

How do g6pc3 mutations in zebrafish correlate with human G6PC3 mutations?

The correlation between g6pc3 mutations in zebrafish and human G6PC3 mutations provides valuable insights into structure-function relationships and disease mechanisms. Given the high degree of conservation between the two orthologs, many pathogenic mechanisms are shared:

Conservation of critical residues and domains:
Human G6PC3 is embedded in the endoplasmic reticulum membrane with 9 transmembrane helices (H1-H9) and 4 cytoplasmic loops (C1-C4) . Zebrafish g6pc3 shares this topological arrangement, with conserved catalytic residues and structural elements. This conservation allows researchers to model specific human mutations in the equivalent zebrafish residues to assess functional consequences.

Functional effects of analogous mutations:
Studies of human G6PC3 mutations have identified several functional categories:

  • Catalytic site mutations: Directly impair enzymatic activity

  • Structural mutations: Disrupt protein folding or stability

  • Membrane integration mutations: Affect proper insertion into the ER membrane

  • Regulatory mutations: Interfere with protein interactions or regulation

When equivalent mutations are introduced into zebrafish g6pc3, similar functional defects are observed. For example, mutations in transmembrane helices typically have more severe consequences than those in cytoplasmic loops in both species . The recombinant adenoviral expression system has proven particularly valuable for comparing the enzymatic activities of wild-type and mutant forms of g6pc3/G6PC3.

Genotype-phenotype correlations:
In humans, G6PC3 mutations with complete loss of enzymatic activity generally cause more severe clinical phenotypes than mutations with residual activity. Similar patterns are observed in zebrafish models, where the severity of neutropenia and metabolic disturbances correlates with the degree of enzymatic impairment. For instance, mutations analogous to human p.S139I and p.R189Q, which retain 49% and 45% of wild-type activity respectively, would be expected to produce milder phenotypes in zebrafish models .

Novel insights from zebrafish models:
Zebrafish models allow for the characterization of novel G6PC3 variants identified in patients, helping to establish pathogenicity and predict clinical outcomes. For example, compound heterozygous patterns involving previously uncharacterized G6PC3 variants have been identified in patients with cyclic neutropenia . Modeling these variants in zebrafish can provide functional validation and insights into the molecular mechanisms underlying the clinical phenotype.

The bidirectional translation between zebrafish and human studies enhances our understanding of g6pc3/G6PC3 function in both species and improves the clinical interpretation of novel variants identified in patients.

What are the major challenges in studying g6pc3 function in zebrafish?

Despite the advantages of zebrafish models, several significant challenges exist in studying g6pc3 function:

Technical challenges:

  • Protein expression and purification: As a multi-pass transmembrane protein, g6pc3 is difficult to express, purify, and maintain in an active form outside its native membrane environment . This complicates biochemical and structural studies.

  • Assay sensitivity: The enzymatic activity of g6pc3 is relatively low, requiring sensitive detection methods with low background. Even optimized recombinant adenoviral expression systems face challenges in detecting residual activity of severely impaired mutants .

  • Antibody specificity: Developing highly specific antibodies for zebrafish g6pc3 has proven challenging, limiting immunodetection approaches for protein localization and quantification.

Biological complexities:

  • Functional redundancy: Zebrafish possess multiple glucose-6-phosphatase genes, which may partially compensate for g6pc3 deficiency, potentially masking phenotypes observed in human patients.

  • Developmental compensation: Genetic compensation mechanisms may be activated during development in response to g6pc3 deficiency, complicating the interpretation of knockout phenotypes.

  • Species-specific metabolic differences: Differences in glucose metabolism between zebrafish and humans may affect the manifestation of g6pc3 deficiency, requiring careful interpretation of metabolic findings.

Translational challenges:

  • Phenotypic differences: Some aspects of human G6PC3 deficiency, such as cardiac and urogenital abnormalities, may manifest differently in zebrafish, complicating direct translation of findings.

  • Phenotypic heterogeneity: The variable clinical presentation of G6PC3 deficiency in humans suggests complex gene-environment interactions that may be difficult to model in laboratory zebrafish.

  • Treatment efficacy assessment: Evaluating potential therapeutics in zebrafish requires appropriate readouts that correlate with clinical outcomes in human patients.

Addressing these challenges requires interdisciplinary approaches and continued methodological innovation to fully leverage the potential of zebrafish models for understanding g6pc3 function and related diseases.

How can advanced techniques enhance our understanding of g6pc3 in zebrafish?

Cutting-edge technologies are transforming our ability to study g6pc3 function in zebrafish, offering unprecedented precision and insight:

Advanced genome editing approaches:

  • Prime editing and base editing: These technologies enable precise modification of specific nucleotides without double-strand breaks, allowing researchers to introduce exact human disease mutations into the zebrafish g6pc3 gene with minimal off-target effects.

  • Conditional and tissue-specific knockouts: Using Cre/lox or similar systems permits temporal and spatial control of g6pc3 inactivation, facilitating the study of tissue-specific roles and avoiding developmental compensation.

  • Allelic series generation: Creating a spectrum of mutations with varying functional impacts enables fine-grained analysis of structure-function relationships and genotype-phenotype correlations.

Advanced imaging techniques:

  • Intravital microscopy: Real-time visualization of neutrophil dynamics in live zebrafish larvae provides insights into cell migration, survival, and function in g6pc3-deficient models.

  • Correlative light and electron microscopy (CLEM): Combines fluorescence imaging with ultrastructural analysis to examine subcellular changes in neutrophils and other cell types affected by g6pc3 deficiency.

  • Metabolic imaging: Techniques such as FLIM (Fluorescence Lifetime Imaging Microscopy) with glucose analogs can visualize glucose metabolism in various tissues of live zebrafish.

Single-cell technologies:

  • Single-cell RNA sequencing: Reveals cell-type-specific transcriptional responses to g6pc3 deficiency, identifying differential effects across cell populations and novel compensatory mechanisms.

  • Single-cell metabolomics: Emerging techniques for analyzing metabolic profiles at the single-cell level can uncover cell-specific metabolic adaptations to g6pc3 deficiency.

  • Spatial transcriptomics: Maps gene expression changes in the anatomical context, providing insights into tissue-specific responses to g6pc3 deficiency.

Systems biology approaches:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data provides a comprehensive view of the molecular and biochemical consequences of g6pc3 deficiency.

  • Network analysis: Identifies key pathways and regulatory networks affected by g6pc3 deficiency, revealing potential therapeutic targets.

  • Mathematical modeling: Develops predictive models of glucose metabolism in different tissues that can simulate the effects of g6pc3 mutations and potential interventions.

These advanced techniques, when applied to zebrafish g6pc3 models, promise to significantly enhance our understanding of the molecular, cellular, and physiological roles of this important enzyme in health and disease.

What are promising research directions for g6pc3 studies in zebrafish?

Several innovative research directions hold particular promise for advancing our understanding of g6pc3 function and related diseases using zebrafish models:

Neutrophil metabolism and function:
Investigating the metabolic requirements of neutrophils and how g6pc3 deficiency disrupts neutrophil energy homeostasis represents a critical research direction. Zebrafish offer unique advantages for studying neutrophil dynamics in vivo, including real-time visualization of neutrophil behavior in transparent larvae. Future studies could explore:

  • Glucose metabolism in neutrophils during different activation states

  • Alternative energy pathways that might compensate for g6pc3 deficiency

  • Metabolic interventions to rescue neutrophil function in g6pc3-deficient zebrafish

Gene therapy approaches:
Zebrafish models provide an excellent platform for testing novel gene therapy strategies for G6PC3 deficiency. Research directions include:

  • Testing adeno-associated virus (AAV) vectors for g6pc3 gene delivery

  • Evaluating CRISPR/Cas9-based gene correction approaches

  • Assessing mRNA therapy for transient g6pc3 expression

  • Developing tissue-specific gene delivery strategies targeting neutrophil progenitors

Drug discovery and repurposing:
The amenability of zebrafish to high-throughput screening makes them ideal for identifying chemical modulators of g6pc3 function or compounds that can rescue g6pc3 deficiency phenotypes:

  • Screening for small molecules that stabilize mutant g6pc3 proteins

  • Identifying compounds that reduce ER stress in neutrophils

  • Discovering drugs that enhance neutrophil survival or production

  • Repurposing approved drugs for treating G6PC3 deficiency

Evolutionary and comparative studies:
Comparing g6pc3 function across species can provide insights into its evolutionary conservation and adaptation:

  • Analyzing g6pc3 sequence and functional conservation across vertebrates

  • Investigating species-specific adaptations in g6pc3 regulation and function

  • Examining how g6pc3 contributes to metabolic adaptation in different environmental conditions

Interaction with other genetic factors:
Understanding how g6pc3 mutations interact with other genetic variants could explain phenotypic variability in human patients:

  • Performing genetic modifier screens in zebrafish g6pc3 models

  • Investigating the interaction between g6pc3 and other neutropenia-associated genes

  • Exploring how common genetic variants affect g6pc3 deficiency manifestations

These research directions leverage the unique advantages of zebrafish models and have significant translational potential for understanding and treating human G6PC3 deficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.