Recombinant Danio rerio Glycerol-3-phosphate acyltransferase 3-like (agpat9l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preference in the order remarks, and we will do our best to meet your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for precise delivery estimates.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
agpat9l; si:ch211-155m12.4; Glycerol-3-phosphate acyltransferase 3-like; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9-like; 1-AGP acyltransferase 9-like; 1-AGPAT 9-like; Lysophosphatidic acid acyltransferase theta-like; LPAAT-theta-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
agpat9l
Target Protein Sequence
MEGYWAVLFPVLKVWFSCVIVLIMLPAMFGISLGITETYMKLLIKTLEWATHRIQRASRA EEILKESASNGLIQRDNSSLEQEIEELRRNRPKSADRGDFTLSDVLYFSRKGFESIVEDD VTQRFTSEELVSWNLLTRTNNNFQYISLRLTVLWVVGVVVRYCILLPLRITLTTIGLTWL VIGTTTVGFLPNCRVKNWLSELVHLMCYRICARGLSATIHFHNKQNRPKKGGICVANHTS PIDVVILANDGCYAMVGQVHGGLMGVLQRAMERSCPHIWFERSEMRDRHLVTQRLKDHVN AKTKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKYSIMS YLLRMMTSWAIVCNVWYLPPMTHEEGEDAVQFANRVKSTIAQQGGLVDLAWDGGLKRAKV KDSFKEQQQKKYSHMVVGEDSSD
Uniprot No.

Target Background

Function
This protein can transfer the acyl-group from acyl-coA to the sn-1 position of glycerol-3-phosphate, a crucial step in glycerolipid biosynthesis. Additionally, it transfers the acyl-group from acyl-coA to the sn-2 position of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid, or LPA), forming 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid, or PA).
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Glycerol-3-phosphate acyltransferase in zebrafish?

Glycerol-3-phosphate acyltransferase (GPAT) catalyzes the first and rate-limiting step in the de novo synthesis of triacylglycerol (TAG). In zebrafish, as in other organisms, this enzyme is crucial for glycerolipid assembly and plays a significant role in lipid droplet formation and energy storage. The enzyme facilitates the acylation of glycerol-3-phosphate, initiating the pathway for phospholipid and TAG synthesis. In research contexts, understanding this function is essential when studying lipid metabolism disorders or using zebrafish as a model for human metabolic diseases .

How is agpat9l expression regulated during zebrafish development?

The regulation of agpat9l expression follows tissue-specific and developmental stage-dependent patterns. Similar to other GPAT family members, agpat9l likely shows highest expression in metabolically active tissues where lipid synthesis is prominent. Based on studies of GPAT homologs, expression regulation typically involves transcription factors responsive to nutritional status and hormonal signals. To properly investigate this regulation, researchers should employ quantitative RT-PCR at different developmental stages (from embryo to adult) and across various tissues, with particular attention to liver, adipose tissue equivalents, and brain. Western blotting with specific antibodies can confirm protein expression patterns correlate with transcriptional data .

What are the methodological approaches for purifying recombinant Danio rerio agpat9l?

Purification of recombinant agpat9l requires careful consideration of the enzyme's biochemical properties. Based on approaches used for other GPAT enzymes, the following methodology is recommended:

  • Clone the full-length agpat9l coding sequence into an appropriate expression vector (pET or pGEX systems work well)

  • Transform into E. coli expression strains (BL21(DE3) or Rosetta for eukaryotic proteins)

  • Optimize expression conditions: temperature (often 16-25°C is better than 37°C for proper folding), induction time, and IPTG concentration

  • For membrane-associated proteins like GPAT:

    • Use mild detergents for solubilization (1% Triton X-100 or n-dodecyl β-D-maltoside)

    • Include glycerol (10-20%) in buffers to stabilize the protein

    • Add reducing agents to prevent oxidation of critical cysteine residues

  • Purify using affinity chromatography (Ni-NTA for His-tagged constructs)

  • Consider size exclusion chromatography as a final purification step

The major challenge with GPAT enzymes is maintaining activity during purification, as they tend to lose function when removed from their native membrane environment .

How can I determine the substrate specificity of recombinant zebrafish agpat9l?

Determining substrate specificity requires in vitro enzyme assays with various acyl-ACPs or acyl-CoAs and glycerol-3-phosphate. Based on studies with other GPAT enzymes, the following methodology is recommended:

  • Prepare radiolabeled substrates ([14C] or [3H] glycerol-3-phosphate) or utilize LC-MS/MS approaches for non-radioactive detection

  • Use purified enzyme in a reaction containing:

    • Buffer (typically Tris-HCl, pH 7.4-8.0)

    • Divalent cations (Mg2+ or Mn2+)

    • Various acyl donors (16:0, 18:0, 18:1, 18:2, 20:4, 22:6 acyl-CoAs)

    • Glycerol-3-phosphate

    • BSA as a fatty acid carrier

  • Reaction products can be separated by thin-layer chromatography or HPLC

Results should be analyzed using Michaelis-Menten kinetics to determine Km and Vmax values for each substrate. Studies with sunflower GPAT showed strong preference for oleic versus palmitic acid, with weak activity towards stearic acid. The zebrafish enzyme may show different preferences that could provide insights into evolutionary adaptations for cold-water organisms .

What experimental approaches can differentiate the function of agpat9l from other GPAT family members in zebrafish?

Distinguishing the specific functions of agpat9l from other GPAT family members requires multiple complementary approaches:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 gene editing for complete knockout

    • Morpholino oligonucleotides for transient knockdown

    • Analysis of resulting phenotypes focusing on lipid metabolism

  • Subcellular localization:

    • Create fluorescent protein fusions to determine if agpat9l localizes to mitochondria or endoplasmic reticulum

    • Co-localization studies with organelle markers

    • This helps classify the enzyme as similar to mammalian GPAT1/2 (mitochondrial) or GPAT3/4 (ER-associated)

  • Substrate specificity profiling:

    • Compare kinetic parameters with other zebrafish GPAT enzymes

    • Investigate differential sensitivity to inhibitors (N-ethylmaleimide sensitivity distinguishes some GPAT isoforms)

  • Complementation studies:

    • Express agpat9l in GPAT-deficient systems (yeast or mammalian cells)

    • Assess which functions are rescued

A comprehensive study published with Rhodnius prolixus identified distinct contributions of different GPAT isoforms to total GPAT activity: 15% in anterior midgut, 50% in posterior midgut and fat body, and 70% in ovary for GPAT1. Similar tissue-specific roles might be expected for zebrafish agpat9l .

What methodological challenges exist when measuring agpat9l activity in zebrafish tissues?

Measuring GPAT activity in zebrafish tissues presents several methodological challenges:

  • Low abundance and instability:

    • GPAT enzymes often represent a small fraction of membrane proteins

    • Activity can rapidly decrease during sample preparation

    • Solution: Prepare fresh samples and include protease inhibitors and reducing agents

  • Membrane association:

    • Proper solubilization is critical for activity

    • Excessive detergent can denature the enzyme

    • Solution: Optimize detergent type and concentration for zebrafish tissues

  • Multiple isoforms:

    • Zebrafish likely express multiple GPAT isoforms with overlapping activities

    • Solution: Use specific inhibitors or antibodies to distinguish isoforms

    • N-ethylmaleimide sensitivity can differentiate some isoforms

  • Substrate preparation:

    • Acyl-CoAs can form micelles affecting enzyme accessibility

    • Solution: Maintain acyl-CoA below critical micellar concentration or use BSA as a carrier

  • Tissue heterogeneity:

    • Different cell types within tissues have varying GPAT expression

    • Solution: Consider cell isolation techniques or single-cell approaches for specific studies

How should I interpret apparent Km differences between wild-type and mutant agpat9l enzymes?

Interpreting Km differences requires careful consideration of enzyme kinetics principles. Based on studies with bacterial GPAT mutants, wild-type enzymes typically display higher substrate affinity (lower Km) than mutant forms. For instance, in E. coli studies, mutations in the GPAT homolog increased the apparent Km for G3P from approximately 90 μM to 1,000-1,250 μM (11-14 fold higher) .

When analyzing your recombinant zebrafish agpat9l data:

  • Statistical validation:

    • Ensure measurement replicates (minimum n=3) with appropriate statistical analysis

    • Confirm that differences exceed experimental error (typically >2-fold is considered significant)

  • Interpretation framework:

    • Higher Km values suggest decreased substrate affinity

    • Consider if mutations affect:
      a. Substrate binding pocket (direct effect on affinity)
      b. Enzyme conformation (indirect effect on substrate access)
      c. Oligomerization state (if applicable)

  • Physiological context:

    • Compare Km values to physiological substrate concentrations

    • Changes may be more significant if they cross this threshold

ParameterWild-type agpat9lMutant agpat9lPhysiological relevance
Km for G3P90-120 μM (estimated)600-1200 μM (est.)G3P concentration in zebrafish tissues: 100-400 μM
Vmax15-25 nmol/min/mg10-20 nmol/min/mgReduced catalytic efficiency
Substrate preferenceOleic > Palmitic > StearicAltered hierarchyMay affect membrane composition

Note: The table contains estimated values based on related GPAT enzymes and should be replaced with actual experimental data for zebrafish agpat9l .

What approaches can resolve contradictory findings regarding agpat9l function in lipid metabolism?

Resolving contradictory findings about agpat9l function requires systematic methodological approaches:

  • Experimental condition standardization:

    • Nutritional status significantly impacts GPAT activity and expression

    • Control feeding state of zebrafish (fed vs. fasted) when comparing studies

    • Temperature conditions should be standardized (GPAT activity is temperature-sensitive)

  • Technical validation:

    • Use multiple methodologies to measure the same parameter

    • For TAG synthesis measurement: combine radioisotope incorporation, lipidomics, and microscopy methods

    • Cross-validate gene expression using different primer sets and reference genes

  • Genetic background considerations:

    • Different zebrafish strains may show variation in lipid metabolism

    • Document complete genetic background information

    • Perform studies in multiple strains to assess result robustness

  • Developmental timing:

    • GPAT expression and function changes during development

    • Precisely document and match developmental stages between studies

    • Consider performing time-course analyses

  • Integrated multi-omics approach:

    • Combine transcriptomics, proteomics, and lipidomics data

    • Look for consistent patterns across different data types

    • Metabolic flux analysis can resolve static measurement contradictions

How can I effectively analyze the impact of agpat9l deficiency on zebrafish fatty acid metabolism?

Analysis of agpat9l deficiency impacts requires a multi-faceted approach:

  • Comprehensive lipid profiling:

    • Quantify major lipid classes (TAG, phospholipids, sphingolipids)

    • Analyze fatty acid composition of each lipid class

    • Use thin-layer chromatography followed by GC-MS or direct LC-MS/MS lipidomics

  • Metabolic flux analysis:

    • Trace incorporation of labeled fatty acids ([13C] or [14C]) into different lipid pools

    • Measure β-oxidation rates using [14C]-palmitate oxidation assays

    • Compare results to studies showing that GPAT1 deficiency increases fatty acid β-oxidation by 2-fold in insect fat body

  • Lipid droplet analysis:

    • Quantify lipid droplet size, number, and distribution using fluorescent microscopy

    • BODIPY or Nile Red staining for neutral lipids

    • Consider electron microscopy for ultrastructural analysis

  • Gene expression compensation:

    • Measure expression of other GPAT family members

    • Assess upregulation of alternative pathways

    • RNA-seq analysis of global transcriptional changes

  • Functional metabolic measurements:

    • Oxygen consumption rate (OCR) with Seahorse or similar technology

    • Measure glycerol release as indicator of lipolysis

    • Glucose tolerance tests to assess systemic metabolic effects

Data interpretation should consider that studies in other systems show GPAT1 deficiency decreases TAG content (50-65% in insect tissues) and increases fatty acid oxidation, suggesting a role in directing fatty acyl chains toward TAG synthesis and away from β-oxidation .

What emerging technologies are advancing our understanding of GPAT enzymes in model organisms?

Several cutting-edge technologies are enhancing research on GPAT enzymes in zebrafish and other model organisms:

  • CRISPR-based genetic screening:

    • High-throughput generation of precise mutations

    • Creation of conditional and tissue-specific knockouts

    • Base editing for introducing specific amino acid changes

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize enzyme localization

    • Live-cell imaging with fluorescent biosensors to monitor lipid metabolism in real-time

    • Correlative light and electron microscopy for structural context

  • Metabolic tracing methods:

    • Stable isotope resolved metabolomics (SIRM)

    • Bio-orthogonal labeling of lipids for tracking in vivo

    • Hyperpolarized NMR for real-time metabolic flux analysis

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, lipidomics)

    • Network analysis of lipid metabolism

    • Computational modeling of metabolic pathways

  • Single-cell analysis:

    • Single-cell RNA-seq to identify cell-type specific roles

    • Spatial transcriptomics to map expression patterns

    • Mass cytometry for protein-level analysis

These technologies facilitate more precise understanding of GPAT function in the complex physiological context of living organisms, moving beyond the traditional biochemical characterizations that have dominated the field .

How can findings from zebrafish agpat9l research be translated to understand human lipid metabolism disorders?

Translating zebrafish agpat9l research to human health applications requires systematic approaches:

  • Comparative genomics:

    • Identify human orthologs of zebrafish agpat9l

    • Compare enzyme structure, substrate specificity, and regulation

    • Analyze conservation of key functional domains and residues

  • Disease modeling:

    • Generate zebrafish models mimicking human GPAT mutations

    • Compare phenotypes with human clinical presentations

    • Validate with patient-derived cell studies

  • Therapeutic screening:

    • Use zebrafish agpat9l mutants for drug discovery

    • Screen compounds that modulate GPAT activity

    • Assess effects on lipid metabolism and related pathways

  • Biomarker identification:

    • Identify lipid species specifically altered by agpat9l dysfunction

    • Validate in human samples from patients with metabolic disorders

    • Develop diagnostic approaches based on these signatures

  • Mechanistic insights:

    • Determine if agpat9l has moonlighting functions beyond lipid synthesis

    • Investigate interactions with other metabolic pathways

    • Explore potential as therapeutic target for metabolic diseases

Researchers should note that while zebrafish provide an excellent model, species differences in lipid metabolism must be considered when translating findings to human applications. The general roles of GPAT in TAG synthesis and lipid droplet formation appear conserved across species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.