Recombinant Danio rerio Glycerol-3-phosphate acyltransferase 3 (agpat9)

What is the molecular structure of Danio rerio GPAT3-like (agpat9l) protein?

Danio rerio GPAT3-like (agpat9l) is a 443-amino acid membrane-associated protein that functions as a glycerol-3-phosphate acyltransferase. The protein (UniProt: A3KGT9) contains multiple transmembrane domains consistent with its localization to the endoplasmic reticulum membrane. The full amino acid sequence is: MEGYWAVLFPVLKVWFSCVIVLIMLPAMFGISLGITETYMKLLIKTLEWATHRIQRASRAEEILKESASNGLIQRDNSSLEQEIEELRRNRPKSADRGDFTLSDVLYFSRKGFESIVEDDVTQRFTSEELVSWNLLTRTNNNFQYISLRLTVLWVVGVVVRYCILLPLRITLTTIGLTWLVIGTTTVGFLPNCRVKNWLSELVHLMCYRICARGLSATIHFHNKQNRPKKGGICVANHTSPIDVVILANDGCYAMVGQVHGGLMGVLQRAMERSCPHIWFERSEMRDRHLVTQRLKDHVNAKTKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKYSIMS YLLRMMTSWAIVCNVWYLPPMTHEEGEDAVQFANRVKSTIAQQGGLVDLAWDGGLKRAKVKDSFKEQQQKKYSHMVVGEDSSD . Protein spatial structure prediction can be performed using I-TASSER for further structural insights .

How does Danio rerio GPAT3-like (agpat9l) compare to other GPAT family members?

The GPAT family comprises multiple isoforms with distinct subcellular localizations. While mammals possess four GPAT isoforms (mitochondria-associated GPAT1/2 and ER-associated GPAT3/4), zebrafish appears to have a streamlined system. The agpat9l in zebrafish shows homology to mammalian GPAT3/4 (ER-associated) based on sequence analysis and predicted membrane topology. Unlike the redundancy observed in mammalian systems, the single-copy nature of agpat9l in zebrafish makes it an excellent model for studying GPAT function without compensatory effects from multiple isoforms. Comparative studies with insect models like Rhodnius prolixus, which has distinct mitochondrial-like (RhoprGPAT1) and ER-associated (RhoprGPAT4) isoforms, further illuminate the evolutionary conservation of GPAT's functional importance in lipid metabolism across species .

What are the optimal expression systems for recombinant Danio rerio GPAT3-like (agpat9l)?

E. coli has been successfully employed for the expression of recombinant Danio rerio GPAT3-like protein. The full-length protein (amino acids 1-443) with an N-terminal His-tag demonstrates good expression levels and maintains functionality. For expression:

• Clone the coding sequence into a vector containing an N-terminal His-tag

• Transform into an appropriate E. coli strain optimized for membrane protein expression

• Induce expression using IPTG under controlled temperature conditions (typically 16-25°C to prevent inclusion body formation)

• Harvest cells and extract the protein using appropriate detergents to solubilize the membrane-associated protein

Alternative expression systems include yeast (Pichia pastoris) for eukaryotic post-translational modifications or insect cell systems for higher-order eukaryotic expression when E. coli-expressed protein shows limited activity .

What purification strategies yield the highest activity for recombinant Danio rerio GPAT3-like (agpat9l)?

A multi-step purification approach is recommended for obtaining high-purity, active GPAT3-like protein:

• Initial extraction: Solubilize membrane fractions using mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS)

• Affinity chromatography: Utilize Ni-NTA resin to capture the His-tagged protein

• Washing: Employ gradient washing with increasing imidazole concentrations (10-40 mM) to remove non-specific binding

• Elution: Elute with 250-300 mM imidazole

• Detergent exchange: If necessary, exchange harsh detergents with milder ones via dialysis

• Size exclusion chromatography: As a polishing step to remove aggregates and improve homogeneity

The purified protein can be concentrated to 0.1-1.0 mg/mL and is most stable when stored with 5-50% glycerol at -20°C/-80°C. Repeated freeze-thaw cycles significantly reduce enzymatic activity and should be avoided .

How can researchers accurately measure GPAT3-like enzymatic activity?

GPAT activity can be assessed through multiple complementary approaches:

Table 1: Methods for Measuring GPAT Activity

The apparent Km for glycerol-3-phosphate typically ranges from 90-1250 μM, varying significantly based on membrane environment and experimental conditions. When designing activity assays, researchers should consider that GPAT activity is the rate-limiting step in the glycerolipid synthesis pathway, making it essential to optimize substrate concentrations and reaction conditions .

What are the critical storage conditions for maintaining GPAT3-like activity?

Proper storage is crucial for preserving enzymatic activity:

• Store purified protein at -20°C/-80°C in buffer containing 6% trehalose and pH 8.0

• Add glycerol to a final concentration of 5-50% (optimal: 50%) to prevent freeze damage

• Aliquot the protein solution to avoid repeated freeze-thaw cycles

• For short-term storage (up to one week), samples can be maintained at 4°C

• Before use, centrifuge vials briefly to bring contents to the bottom

• Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

What is the physiological role of GPAT3-like (agpat9l) in zebrafish lipid metabolism?

GPAT3-like enzyme in zebrafish plays fundamental roles in lipid metabolism, primarily:

• Triacylglycerol synthesis: Catalyzes the initial acylation of glycerol-3-phosphate to form lysophosphatidic acid, the rate-limiting step in the glycerol phosphate pathway leading to triacylglycerol (TAG) synthesis

• Membrane phospholipid biosynthesis: Contributes to the formation of phospholipid precursors essential for membrane biogenesis

• Lipid droplet formation: Based on studies in other organisms, GPAT enzymes are directly linked to lipid droplet biogenesis and expansion

• Cellular energy storage: Facilitates energy storage by directing fatty acids toward TAG synthesis rather than oxidation

Research in other model organisms like insects shows that GPAT deficiency results in approximately 50-65% decrease in TAG content and impaired lipid droplet expansion, suggesting a similarly critical role in zebrafish .

How does GPAT3-like activity respond to different nutritional and developmental states?

GPAT activity exhibits significant modulation based on nutritional status:

Table 2: GPAT Regulation Under Different Physiological Conditions

The activity is further regulated by substrate availability, particularly intracellular glycerol-3-phosphate concentration. Studies in hepatocytes demonstrate a hyperbolic relationship between triacylglycerol synthesis and cellular glycerol-3-phosphate content, with glycerol-3-phosphate becoming limiting for esterification below certain thresholds (0.3-0.4 μmol/g in fed state and 0.5-0.65 μmol/g in starved state) .

What experimental approaches are most effective for studying GPAT3-like function in vivo?

Multiple complementary approaches can be employed:

• Genetic manipulation:

  • Morpholino knockdown for transient suppression

  • CRISPR-Cas9 genome editing for stable mutant generation

  • Transgenic overexpression to assess gain-of-function effects

• Metabolic profiling:

  • Lipidomics to quantify changes in lipid profiles

  • Metabolic flux analysis using stable isotope-labeled precursors

  • Analysis of fatty acid oxidation rates in GPAT-deficient tissues

• Cellular imaging:

  • Fluorescent lipid droplet staining to assess morphology and distribution

  • Subcellular localization studies using fluorescently tagged GPAT3-like protein

  • Live imaging to track lipid droplet dynamics

• Multi-omics integration:

  • Combine transcriptomics, proteomics, and lipidomics data

  • Phosphoproteomics to identify regulatory phosphorylation sites

  • Network analysis to map pathway interactions

How can researchers employ mass spectrometry to study GPAT3-like function and regulation?

Mass spectrometry offers powerful approaches for comprehensive analysis:

• Activity-based proteomics:

  • Use activity-based protein profiling (ABPP) with clickable lipid analogs

  • Identify GPAT3-like interacting proteins via proximity labeling coupled with MS

• LC-ESI-MS/MS methodology:

  • Sample preparation on reverse-phase analytical columns (50-cm × 75 μm ID)

  • Column temperature maintenance at 50°C

  • Mobile phase: Solvent A (0.1% FA in water) and Solvent B (0.1% FA in 80% ACN)

  • Gradient elution: 224.9 min linear gradient from 2% to 30% B, then to 60% B

  • Mass spectrometer settings: Positive ion mode, m/z range 350–1600 for MS1, automatic gain control target of 3×10^6 for MS1

  • Fragmentation using higher energy C-trap collision dissociation (HCD) at 27% normalized collision energy

• Data analysis pipeline:

  • Filter proteins labeled "only identified by site," "reverse," or "contaminants"

  • Require at least five valid values among six biological replicates (70%)

  • Replace missing values with those derived from normal distribution

  • Determine significant changes using Student's t-test with Permutation-based FDR (q-value < 0.05)

  • For phosphoproteomics, consider only class one phosphosites (localization probability > 0.75)

What evolutionary insights can be gained from comparative analysis of GPAT3-like across species?

Comparative genomic and functional analyses provide valuable evolutionary perspectives:

• Sequence conservation analysis:

  • Apply multiple sequence alignment using DNAMAN software

  • Calculate nucleotide diversity (π) and Tajima's D using DnaSP5.0

  • Identify conserved catalytic motifs and regulatory elements

• Structural comparison:

  • Predict transmembrane domains using TMHMM software

  • Generate protein spatial structures using I-TASSER

  • Align structures to identify conserved catalytic sites and substrate binding regions

• Functional divergence evaluation:

  • Compare kinetic parameters (Km, Vmax) across species

  • Assess substrate preferences and specificity

  • Analyze complementation capacity through cross-species expression

Studies in peanut revealed that AhGPAT9 genes from A- and B-genomes share 95.65% similarity with 165 site differences, demonstrating how gene duplication can lead to functional specialization. Similar approaches can illuminate the evolutionary relationships between zebrafish agpat9l and orthologs in other vertebrates, providing insights into functional conservation and specialization .

How can researchers address challenges in resolving membrane protein structures for GPAT3-like enzymes?

Membrane protein structural analysis presents unique challenges that can be addressed through:

• Sample preparation optimization:

  • Screen detergents systematically (DDM, LMNG, GDN) for optimal solubilization

  • Employ nanodiscs or lipid cubic phase crystallization

  • Utilize styrene maleic acid copolymers (SMALPs) to extract proteins with native lipid environment

• Structural biology approaches:

  • X-ray crystallography with lipidic cubic phase for membrane proteins

  • Cryo-electron microscopy for larger membrane protein complexes

  • NMR spectroscopy for dynamic studies of smaller domains

  • Molecular dynamics simulations to model membrane interactions

• Functional validation:

  • Site-directed mutagenesis of predicted catalytic residues

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational changes

  • Chemical cross-linking coupled with mass spectrometry to identify domain interactions

These approaches can help overcome the inherent difficulties in studying membrane-associated enzymes like GPAT3-like protein, providing critical insights into their structure-function relationships that inform both basic science and potential therapeutic applications.

How should researchers interpret conflicting results in GPAT functional studies?

Conflicting results in GPAT studies often arise from methodological differences and biological complexity:

• Source of discrepancies:

  • Different expression systems affecting post-translational modifications

  • Variable lipid compositions affecting enzyme behavior

  • Divergent assay conditions (pH, temperature, substrate concentrations)

  • Presence of endogenous GPAT activity in experimental systems

• Resolution strategies:

  • Systematically test multiple experimental conditions

  • Employ complementary assay methods

  • Use genetic knockout/knockdown systems to eliminate background activity

  • Correlate in vitro findings with in vivo phenotypes

• Data integration framework:

  • Apply statistical methods appropriate for the experimental design

  • Consider both enzymatic parameters and physiological outcomes

  • Use multiple model systems to establish conserved functions

  • Integrate findings from different experimental approaches for a comprehensive understanding

The apparent Km differences observed for GPAT enzymes (ranging from 90 μM to over 1000 μM) illustrate how experimental conditions can dramatically affect measured parameters, emphasizing the need for standardized methodologies and thorough reporting of experimental conditions .

What bioinformatic tools are most valuable for GPAT3-like sequence and function analysis?

A comprehensive bioinformatic workflow includes:

• Sequence analysis:

  • ExPASy web server for primary sequence analysis

  • TMHMM for transmembrane domain prediction

  • PROSITE for motif identification

  • PSIPRED for secondary structure prediction

• Evolutionary analysis:

  • MEGA for phylogenetic tree construction

  • DnaSP5.0 for genetic diversity assessment

  • PAML for detecting selection signatures

  • ConSurf for conservation mapping on structures

• Structural prediction:

  • I-TASSER for protein structure modeling

  • AlphaFold for high-accuracy structure prediction

  • PyMOL for structure visualization and analysis

  • HADDOCK for protein-substrate docking simulations

• Functional prediction:

  • KEGG for pathway mapping

  • STRING for protein-protein interaction networks

  • Metascape for functional annotations and enrichment analysis

  • EnrichR for gene set enrichment analysis