Recombinant Danio rerio Heme transporter hrg1-A (slc48a1b)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Danio rerio Heme transporter HRG1-A (slc48a1b) is a protein product derived from the zebrafish (Danio rerio) gene slc48a1b, a paralog of the solute carrier family 48 member 1 (SLC48A1). This transporter plays a critical role in heme-iron recycling, particularly in macrophage-mediated erythrophagocytosis . The recombinant form enables functional and structural studies to elucidate heme transport mechanisms in vertebrates.

Functional Role in Heme-Iron Recycling

HRG1-A facilitates heme transport from phagolysosomal compartments to the cytosol, a process vital for iron homeostasis. Key findings include:

In Vivo and In Vitro Functions

  • Heme Transport: Rescues heme-dependent growth in hem1Δ yeast mutants at low heme concentrations (0.25 μM), comparable to known transporters like CeHRG-1 .

  • Macrophage Activity: In zebrafish, HRG1-A and its paralog HRG1-B are essential for kidney macrophages to recycle heme-iron from senescent erythrocytes .

  • Genetic Knockout Effects: Double knockout (DKO) zebrafish show heme sequestration in kidney macrophages and systemic iron deficiency .

Research Applications and Experimental Data

Recombinant HRG1-A is utilized to study heme transport mechanisms and related pathologies.

Functional Assays

  • Yeast Complementation: HRG1-A restores growth in heme-deficient hem1Δ yeast, confirming transport activity .

  • Knockout Models: DKO zebrafish (hrg1a and hrg1b mutants) exhibit impaired iron accumulation and dysregulated immune gene expression .

Comparative Analysis with Mammalian Orthologs

HRG1-A shares functional homology with mammalian SLC48A1:

Table 2: Cross-Species Comparison of HRG1/SLC48A1 Function

SpeciesGeneRole in Heme TransportPhenotype of Deficiency
Zebrafishslc48a1bLysosomal heme export in kidney macrophagesHeme sequestration, iron deficiency
MouseSlc48a1Phagolysosomal heme recycling in RES macrophagesHemozoin accumulation, anemia
HumanSLC48A1Macrophage iron homeostasisLinked to iron metabolism disorders

Implications for Biomedical Research

  • Iron Deficiency Disorders: HRG1-A studies provide insights into pathologies caused by impaired heme-iron recycling .

  • Therapeutic Targets: Modulating HRG1/SLC48A1 activity could address anemia or iron overload conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc48a1b; hrg1a; zgc:63994; Heme transporter hrg1-A; zHRG-1; Heme-responsive gene 1 protein homolog A; HRG-1A; Solute carrier family 48 member 1-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc48a1b
Target Protein Sequence
MAFNKTYIRVGYSCMGMLVGFSAFLVWNIAYKQPWTAAMGGLSGVLALWALVTHIMYIQD YWRTWLKGLKFFMAMGVIFSVLSIVAFISFLCVAISRQQSLTDPTSLYLSCVWSFMSLKW SFLLTLYSHRYRKEFADISILNDF
Uniprot No.

Target Background

Function
Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.
Gene References Into Functions
  1. Transient knockdown of hrg-1 in zebrafish leads to hydrocephalus, yolk tube malformations, and, most notably, severe defects in erythropoiesis. These phenotypes are completely rescued by worm HRG-1. PMID: 18418376
Database Links
Protein Families
HRG family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed throughout the embryo, including the central nervous system.

Q&A

What is the functional role of hrg1-A (slc48a1b) in zebrafish?

Hrg1-A functions as a heme transporter essential for macrophage-mediated heme-iron recycling during erythrophagocytosis in zebrafish. It works in concert with its paralog Hrg1-B to mobilize heme from the erythrophagosome into the cytosol, facilitating iron recycling from damaged red blood cells. Genetic evidence from zebrafish models demonstrates that Hrg1 is critical for this process specifically in kidney macrophages, which serve as the primary site for erythrophagocytosis in adult zebrafish .

The protein contains four transmembrane domains with cytoplasmic N- and C-termini and conserved amino acids implicated in heme transport. Functional studies show that genetic ablation of both hrg1 paralogs in double knockout (DKO) animals results in lower iron accumulation alongside higher amounts of heme sequestered in kidney macrophages, confirming its essential role in heme-iron transport .

How does hrg1-A compare structurally and functionally with its paralog hrg1-B?

Structurally, hrg1-A (slc48a1b) and hrg1-B (slc48a1a) share significant sequence homology:

Featurehrg1-A (slc48a1b)hrg1-B (slc48a1a)Similarity
Chromosome locationChromosome 6Chromosome 23-
Protein identity--73%
Protein similarity--86%
Transmembrane domains44Identical
Terminal orientationCytoplasmic N- and C-terminiCytoplasmic N- and C-terminiIdentical

Both proteins are phylogenetically related to C. elegans HRG-1 and HRG-4, as well as mouse and human HRG1 homologs . Functionally, both paralogs exhibit heme transport activity, although their expression patterns differ slightly across tissues. While both are upregulated in kidney following hemolysis, only hrg1-A shows significant upregulation in the spleen, suggesting some tissue-specific functional differences .

What expression patterns does hrg1-A exhibit during development and in adult tissues?

During zebrafish development, hrg1-A mRNA is present from the earliest embryonic stages:

  • Detectable in one-cell embryos (maternal deposition during oogenesis)

  • Displays similar temporal expression patterns to hrg1-B throughout development

  • Ubiquitously expressed throughout developing embryos, with high expression in the central nervous system

In adult zebrafish, tissue-specific qRT-PCR reveals that hrg1-A is expressed in multiple tissues but shows distinctive regulation patterns during hemolysis:

  • Significantly upregulated in kidney and spleen following phenylhydrazine (PHZ)-induced hemolysis

  • Shows more pronounced upregulation in kidney compared to spleen

  • Unlike hrg1-B, hrg1-A is upregulated in spleen during hemolysis

  • Neither paralog shows significant expression changes in liver during hemolysis

What experimental approaches can verify the heme transport function of recombinant hrg1-A?

To verify the heme transport function of recombinant hrg1-A, researchers can employ several complementary approaches:

  • Yeast complementation assays: Express hrg1-A in hem1Δ yeast mutants and assess growth rescue in the presence of exogenous heme. This approach has confirmed that wild-type hrg1-A supports heme-dependent growth while mutant forms fail to rescue the phenotype .

  • In vitro transport assays: Reconstitute purified recombinant hrg1-A in proteoliposomes and measure heme transport using fluorescent heme analogs or radiolabeled heme.

  • Cell culture studies: Express hrg1-A in mammalian cell lines and assess subcellular localization during erythrophagocytosis using immunofluorescence microscopy, especially colocalization with phagolysosomal markers.

  • Spectroscopic analysis: Purify recombinant hrg1-A and characterize its heme-binding properties using absorption spectroscopy, similar to studies conducted with Bach1 that revealed specific Soret peaks (423 and 371 nm) indicating Cys coordination as an axial ligand .

What methods are most effective for generating and validating hrg1-A knockout models?

Based on published research, CRISPR/Cas9 genome editing has proven highly effective for generating hrg1-A knockout models. The following methodological considerations are critical:

  • Target selection: Design guide RNAs targeting early exons, particularly exon 2 which contains the original ATG translation start site. In published studies, a 61 nt deletion with a 7 nt insertion (-61, +7) in exon 2 successfully disrupted hrg1-A function .

  • Validation approaches:

    • Genomic PCR and sequencing to confirm mutations

    • RT-PCR and qRT-PCR to verify disruption of mRNA expression

    • Western blotting with anti-Hrg1 antibodies to confirm protein loss

    • Functional validation using heme-dependent growth assays in heterologous systems (e.g., hem1Δ yeast mutants)

  • Knockout verification controls:

    • Test whether truncated proteins retain partial function

    • Express mutant constructs in heterologous systems to assess residual activity

    • Use antibodies targeting different protein regions to ensure complete loss of function

  • Phenotypic analysis:

    • Assess iron accumulation in kidney macrophages using Perl's Prussian blue staining

    • Examine heme sequestration through heme autofluorescence microscopy

    • Evaluate systemic iron parameters through quantification of non-heme iron

How does hemolysis affect hrg1-A expression and what mechanisms regulate this response?

Hemolysis significantly impacts hrg1-A expression through multiple regulatory mechanisms:

  • Tissue-specific upregulation: Following phenylhydrazine (PHZ)-induced hemolysis, hrg1-A mRNA is significantly upregulated in kidney and spleen, but not in liver tissue .

  • Time-dependent regulation: In bone marrow-derived macrophages (BMDMs), Hrg1 expression increases progressively during erythrophagocytosis in a time-dependent manner, with both mRNA and protein levels rising with continued exposure to RBCs .

  • Dose-dependent response: The magnitude of hrg1 upregulation corresponds to the ratio of RBCs to macrophages, suggesting that the response is calibrated to the hemolytic load .

  • Dual regulation by heme and iron: Both heme and iron independently contribute to hrg1 regulation. Iron chelation with deferoxamine (DFO) only partially suppresses hrg1 induction during erythrophagocytosis, indicating that heme itself is a significant regulator .

  • Coordinated expression with other iron metabolism genes: hrg1-A upregulation occurs concurrently with increased expression of Hmox1 (heme degradation) and Fpn1 (iron export), suggesting coordination within a broader heme-iron recycling program .

What are the molecular consequences of hrg1-A/B double knockout in zebrafish kidney?

RNA-seq analysis of kidney tissue from hrg1-A/B double knockout (DKO) zebrafish reveals extensive transcriptional reprogramming:

How can researchers distinguish between the specific functions of hrg1-A versus hrg1-B?

Distinguishing the specific functions of hrg1-A from hrg1-B requires multiple complementary approaches:

  • Single knockout analysis: Generate and characterize single knockouts of each paralog to identify non-redundant functions. Published research shows that specific phenotypes may be more pronounced in double knockouts, suggesting partial functional redundancy .

  • Tissue-specific expression analysis: Quantify paralog-specific expression in different tissues and under various conditions (e.g., hemolysis, iron deficiency) using paralog-specific primers for qRT-PCR and in situ hybridization .

  • Paralog-specific rescue experiments: Perform rescue experiments in DKO models by selectively expressing either hrg1-A or hrg1-B to determine which phenotypes can be complemented by each paralog.

  • Chimeric protein analysis: Create chimeric proteins containing domains from both paralogs to identify regions responsible for paralog-specific functions.

  • Differential regulation analysis: Compare the transcriptional and post-transcriptional regulation of both paralogs during development and in response to stressors such as hemolysis or iron deficiency .

What are the implications of hrg1-A research for understanding human heme metabolism disorders?

Research on zebrafish hrg1-A has significant implications for understanding human disorders of heme metabolism:

  • Human HRG1 variants: Exome sequencing projects have identified several missense variants in human HRG1 (G73S, S82L, W115C) with low frequency in populations, potentially linking HRG1 dysfunction to iron metabolism disorders .

  • Microcytic anemia: Sequencing of patient cohorts with unexplained microcytic anemia has identified a sequence variant in HRG1/SLC48A1 (c.107C>T, P36L), suggesting potential involvement in human disease .

  • Reticuloendothelial system function: Given the high expression of HRG1 in macrophages of the reticuloendothelial system in humans, dysfunction may impact systemic iron recycling, which processes approximately 5 million RBCs per second .

  • Potential therapeutic targets: Understanding hrg1-A function in zebrafish provides potential therapeutic targets for disorders of iron recycling and utilization.

  • Biomarker development: The distinctive regulation of hrg1 during hemolysis and erythrophagocytosis suggests its potential as a biomarker for diseases involving altered RBC turnover or macrophage dysfunction.

What are the optimal techniques for studying hrg1-A protein-protein interactions?

To effectively study hrg1-A protein-protein interactions, researchers should consider these methodological approaches:

  • Co-immunoprecipitation: Use anti-Hrg1 antibodies to pull down native protein complexes from zebrafish tissue lysates, particularly from kidney following hemolysis induction.

  • Proximity labeling techniques: Express hrg1-A fused to BioID or APEX2 to identify proximal proteins within the phagolysosomal membrane during erythrophagocytosis.

  • Split-reporter assays: Utilize bimolecular fluorescence complementation (BiFC) or split-luciferase assays to validate specific interactions in cell culture models.

  • Crosslinking mass spectrometry: Apply chemical crosslinking followed by mass spectrometry to capture transient interactions within membrane compartments.

  • Yeast two-hybrid membrane system: Adapt conventional Y2H systems for membrane proteins to screen for potential interactors.

When performing these studies, it's critical to consider that hrg1-A localizes to phagolysosomal membranes during erythrophagocytosis, similar to mammalian HRG1 which colocalizes with NRAMP1 on phagolysosomal membranes surrounding ingested senescent RBCs .

How can researchers effectively analyze transcriptomic data from hrg1 knockout models?

When analyzing transcriptomic data (such as RNA-seq) from hrg1 knockout models, consider these methodological recommendations:

  • Pathway analysis focus: Based on published findings, particular attention should be paid to genes involved in:

    • Heme metabolism pathways

    • Iron transport and storage

    • Immune system function and inflammation

    • Lysosomal and phagosomal processes

  • Integration with protein-level data: Correlate transcriptomic changes with protein-level alterations through proteomics or targeted Western blotting of key pathway components.

  • Cell type deconvolution: Since kidney tissue contains multiple cell types, computational deconvolution methods should be applied to identify macrophage-specific transcriptional changes.

  • Time-course analysis: Consider temporal dynamics by analyzing transcriptomic changes at multiple timepoints following hemolysis induction.

  • Comparative analysis with mammalian models: Cross-reference zebrafish findings with existing datasets from mammalian models of altered heme-iron recycling to identify evolutionarily conserved mechanisms.

What are the optimal conditions for recombinant expression and purification of functional hrg1-A protein?

Based on the available research, the following methodological considerations are important for recombinant expression and purification of functional hrg1-A:

  • Expression systems:

    • E. coli: While challenging for membrane proteins, specialized strains (C41, C43) with modified expression vectors containing fusion partners (MBP, SUMO) can improve yields

    • Yeast (S. cerevisiae or P. pastoris): More suitable for membrane protein expression with native folding machinery

    • Insect cells: Baculovirus expression system offers eukaryotic processing in high-yield format

  • Purification strategy:

    • Two-step affinity purification using N- and C-terminal tags

    • Solubilization with mild detergents (DDM, LMNG) to maintain native conformation

    • Size exclusion chromatography to separate monomeric from aggregated forms

  • Functional validation:

    • Heme binding assessment using absorption spectroscopy (expected Soret peaks at specific wavelengths)

    • Reconstitution into proteoliposomes for transport assays

    • Thermal stability assays in the presence/absence of heme substrate

  • Critical controls:

    • Mutant forms with altered heme-binding residues (identified by sequence alignment)

    • Parallel purification of human HRG1 for comparative functional studies

    • Negative controls lacking critical transmembrane domains

How can researchers overcome the challenges of studying membrane proteins like hrg1-A?

Membrane proteins present unique experimental challenges. For hrg1-A specifically, researchers should consider:

  • Antibody development and validation:

    • Generate antibodies against multiple epitopes, particularly the cytoplasmic N- and C-termini

    • Validate antibody specificity using tissues from knockout models

    • Consider generating epitope-tagged versions for detection with commercial antibodies

  • Localization studies:

    • Use subcellular fractionation to enrich for phagolysosomal membranes

    • Employ super-resolution microscopy to precisely localize hrg1-A during erythrophagocytosis

    • Utilize correlative light and electron microscopy (CLEM) for ultrastructural localization

  • Functional assays:

    • Develop fluorescence-based heme transport assays in intact cells

    • Utilize the hem1Δ yeast complementation system as a functional readout

    • Consider heterologous expression in mammalian macrophage cell lines

  • Addressing functional redundancy:

    • Generate conditional knockout models to bypass potential developmental effects

    • Create tissue-specific knockouts to focus on kidney macrophage function

    • Develop methods to quantify heme transport activity in isolated kidney macrophages

What experimental controls are essential when investigating hrg1-A function during hemolysis?

When studying hrg1-A function during hemolysis, these experimental controls are critical:

  • Hemolysis induction controls:

    • Titrate phenylhydrazine (PHZ) dose to achieve consistent hemolysis

    • Include time course measurements to capture the dynamic response

    • Quantify hemolysis through plasma hemoglobin or haptoglobin measurements

  • Tissue-specific controls:

    • Always analyze multiple tissues (kidney, spleen, liver) to distinguish tissue-specific responses

    • Include both heme-recycling (kidney, spleen) and non-recycling tissues (liver) for comparison

  • Gene expression controls:

    • Measure multiple genes in the heme-iron recycling pathway (hmox1, fpn1) alongside hrg1-A

    • Use iron chelation (DFO) to distinguish heme-specific from iron-dependent responses

  • Imaging controls:

    • Use specific staining methods to distinguish heme from non-heme iron (Perl's Prussian blue)

    • Employ autofluorescence to detect accumulated heme in tissues

    • Include appropriate negative controls (non-hemolyzed animals) and positive controls (animals with known iron accumulation)

  • Genetic controls:

    • Compare single knockouts of hrg1-A and hrg1-B with double knockouts

    • Include heterozygous animals to assess dose-dependent effects

    • Use paralog-specific rescue experiments to confirm specificity

What are the promising research areas for understanding hrg1-A regulation and function?

Several promising research directions emerge from current knowledge about hrg1-A:

  • Transcriptional regulation: Identify transcription factors that upregulate hrg1-A during hemolysis. The involvement of heme-responsive transcription factors like Bach1, which is inhibited by heme leading to derepression of target genes, may be relevant .

  • Post-translational modifications: Investigate potential phosphorylation, ubiquitination, or other modifications that might regulate hrg1-A trafficking or activity during erythrophagocytosis.

  • Interaction with circadian rhythm: Explore the connection between hrg1-A function and circadian regulation of heme metabolism, given the established links between circadian transcription factors and heme-responsive elements .

  • microRNA regulation: Examine potential regulation by miRNAs, particularly considering the heme-dependent activity of the RNA-binding protein DGCR8 that participates in miRNA processing .

  • Comparative analysis across vertebrates: Compare the function and regulation of hrg1 homologs across different vertebrate species to identify conserved and divergent features.

How might hrg1-A research inform therapeutic approaches for iron metabolism disorders?

Research on hrg1-A has several potential translational applications:

  • Biomarker development: Given that human HRG1 variants have been identified in patients with unexplained microcytic anemia, developing diagnostic markers based on HRG1 function could help identify patients with specific defects in heme-iron recycling .

  • Drug discovery targets: The heme transport function of hrg1-A represents a potential therapeutic target. Small molecules that modulate its activity could be developed for conditions involving defective heme-iron recycling.

  • Gene therapy approaches: Understanding the specific functions of hrg1-A could inform gene therapy strategies for human disorders involving defective HRG1 function.

  • Engineered macrophages: Knowledge of hrg1-A function could enable the development of engineered macrophages with enhanced heme-iron recycling capacity for cell-based therapies.

  • Erythrophagocytosis enhancement: Strategies to upregulate or enhance HRG1 function might improve iron recycling in conditions characterized by ineffective erythrophagocytosis, such as certain anemias or inflammatory conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.