Recombinant Danio rerio Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (herpud2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Homocysteine-Responsive Endoplasmic Reticulum-Resident Ubiquitin-Like Domain Member 2 Protein (Herpud2)

Recombinant Danio rerio Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (Herpud2) is a protein expressed in E. coli and tagged with N-terminal His. The protein, with the accession number Q6NYI0, is a full-length (1-397aa) protein . Herpud2, also known as HERPUD family member 2, is predicted to participate in the endoplasmic reticulum unfolded protein response, acting upstream within this response and located in the membrane . It is orthologous to human HERPUD2 .

Gene Information

The gene name for this protein is herpud2, with synonyms including zgc:56020 and zgc:76968 . The protein is from zebrafish (Danio rerio) .

Protein Properties

PropertyDescription
SpeciesZebrafish
SourceE. coli
TagHis
Protein LengthFull Length (1-397)
FormLyophilized powder
AA SequenceMDQGTVDSPVTLVIKAPNQKYDDQTINCFLNWTVEKLKKHISNVYPSKPLSKDQRLVYSGRLLQDHLQLRDVLRKQDEYHMVHLVCASRSPPSSPTSDSHFSTTDSSSSTSDSAGPSLSSTPSQEAQANSDGLRHRGNPAATHGLNPAPTGVMQRPEGMPLPMQGGPAAGFPTHPMYMPMQMFWWQQMYARHYYVQYQAAIAASRASSVAPSPSLSAGPATQPVQPNEPAAPMGPNPAPPEDRPANPNIQMNAQGGAMLNDDELNRDWLDWMYTVSRAAILLSIVYFYSSFGRFVMVIGAMLLVYLHQAGWFPFRAELQNPRAEEGAQDEADQNQDMQEMERMMDEGIEDDEGDSGEEGPDDPMNPGPHQPGFLSATWSFISTFFTSLIPEGPPQAAN
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .

Function and Role in ERAD

HERPUD2 is a homolog of HERP1 and is involved in endoplasmic reticulum-associated degradation (ERAD) . HERPUD2 shares 38% sequence identity and 51% homology with HERP1 and contains a ubiquitin-like (UBL) domain at the N terminus and a hydrophobic segment near the C-terminal region . Studies indicate that both the N and C termini of HERP2 are exposed to the cytosol .

HERPUD2 is an integral component of the HRD1-SEL1L-DERL2 complex . It functions with HERP1 in the degradation of both glycosylated and non-glycosylated SHH proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
herpud2; zgc:56020; zgc:76968; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-397
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
herpud2
Target Protein Sequence
MDQGTVDSPVTLVIKAPNQKYDDQTINCFLNWTVEKLKKHISNVYPSKPLSKDQRLVYSG RLLQDHLQLRDVLRKQDEYHMVHLVCASRSPPSSPTSDSHFSTTDSSSSTSDSAGPSLSS TPSQEAQANSDGLRHRGNPAATHGLNPAPTGVMQRPEGMPLPMQGGPAAGFPTHPMYMPM QMFWWQQMYARHYYVQYQAAIAASRASSVAPSPSLSAGPATQPVQPNEPAAPMGPNPAPE DRPANPNIQMNAQGGAMLNDDELNRDWLDWMYTVSRAAILLSIVYFYSSFGRFVMVIGAM LLVYLHQAGWFPFRAELQNPRAEEGAQDEADQNQDMQEMERMMDEGIEDDEGDSGEEGPD DPMNPGPHQPGFLSATWSFISTFFTSLIPEGPPQAAN
Uniprot No.

Target Background

Function
Potentially involved in the unfolded protein response (UPR) pathway.
Gene References Into Functions
  1. PRKCSH acts as a chaperone-like molecule, preventing endoplasmic reticulum-associated degradation of TRPP2. PMID: 19801576
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the known subcellular localizations of herpud2 in zebrafish cells?

Immunofluorescence studies of HERP2 (the mammalian homolog of zebrafish herpud2) have demonstrated that the protein displays perinuclear localization that overlaps with ER markers, indicating its predominant localization to the endoplasmic reticulum . Cell fractionation experiments have confirmed that HERP2 is exclusively present in membrane fractions, not in cytosolic fractions, establishing it as a membrane-bound protein, similar to HERP1 . This localization pattern is consistent with its proposed function in the ERAD pathway at the ER membrane.

How is herpud2 expression regulated during zebrafish development?

While comprehensive developmental expression profiling specifically for zebrafish herpud2 is limited in the current literature, broader studies have implicated herpud2 in important developmental processes. The gene has been identified in genomic analyses as being located on the same BAC (zC215K15) as the critical developmental transcription factor Tbx20, which regulates embryonic heart growth in zebrafish . This genomic proximity suggests potential co-regulation in certain developmental contexts, particularly in cardiac development. Unlike its related protein HERP1, which shows significant induction during ER stress, HERP2 (including zebrafish herpud2) maintains constitutive expression in cells, indicating differential regulation mechanisms between these family members .

What factors influence herpud2 gene expression in different zebrafish tissues?

Zebrafish herpud2 expression appears to be tissue-specific and condition-dependent. Research has revealed that herpud2 is expressed in skeletal muscle and shows differential regulation in response to denervation, suggesting a potential role in neurogenic atrophy response mechanisms . Additionally, quantitative PCR analysis has demonstrated that herpud2 expression levels vary between cellular states, with lower expression in proliferating myoblasts compared to differentiated myotubes . This indicates that herpud2 regulation may be linked to cell differentiation status and tissue-specific signaling pathways, rather than being uniformly expressed across all zebrafish tissues.

What is the relationship between ER stress and herpud2 expression in zebrafish?

Unlike HERP1, which is highly inducible during ER stress, HERP2 (herpud2) demonstrates constitutive expression in cells regardless of ER stress conditions . This distinct expression pattern suggests that herpud2 may play a more fundamental role in basal cellular functions rather than being primarily a stress-responsive factor. The constitutive expression of herpud2 could indicate its importance in maintaining normal ER homeostasis and protein quality control even under non-stressed conditions, potentially serving as a buffer for the ERAD system to handle routine protein misfolding events.

How does zebrafish herpud2 contribute to the ERAD pathway?

Zebrafish herpud2, similar to its mammalian counterpart HERP2, functions as an integral component of the HRD1-SEL1L-DERL2 complex that mediates ERAD . Within this complex, HERP proteins act as essential adaptors between the E3 ubiquitin ligase HRD1 and DERL2, helping to organize a functional retrotranslocation complex. Co-immunoprecipitation experiments have demonstrated that both HERP1 and HERP2 are part of the HRD1-SEL1L-DERL2 complex, supporting their role in bridging these components . This function is critical for the efficient degradation of misfolded ER proteins through the ERAD pathway, as knockdown of both HERP proteins simultaneously results in significant inhibition of substrate degradation .

What experimental evidence supports herpud2's role in protein quality control?

Knockdown experiments using siRNA have demonstrated that simultaneous depletion of both HERP1 and HERP2 results in significant stabilization of various ERAD substrates, including SHH-C, SHH N278A (a nonglycosylated variant), and NHK (null Hong Kong α1-antitrypsin) . Cycloheximide chase experiments have shown that when both HERP proteins are depleted, there is strong inhibition of substrate degradation, while depletion of either protein individually has a less pronounced effect . Additionally, co-immunoprecipitation studies have confirmed that HERP2 interacts with components of the HRD1 complex, providing physical evidence for its involvement in the ERAD machinery . These findings collectively support herpud2's essential role in protein quality control through the ERAD pathway.

What are the optimal conditions for expressing recombinant zebrafish herpud2 protein?

For efficient expression of recombinant zebrafish herpud2, the full-length protein (amino acids 1-397) can be expressed in E. coli expression systems with an N-terminal His tag . The protein should be purified under native conditions using standard affinity chromatography techniques. The resulting purified protein is typically stored as a lyophilized powder or in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% and store aliquots at -20°C or -80°C to prevent repeated freeze-thaw cycles . When reconstituting the lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What cell culture systems are suitable for studying zebrafish herpud2 function?

Several cell culture systems have been successfully employed to study HERP protein function, which can be adapted for zebrafish herpud2. Human 293T cells grown in DMEM supplemented with 10% fetal bovine serum and antibiotics have been effectively used for expression and interaction studies involving HERP proteins . For zebrafish-specific studies, zebrafish embryonic cell lines such as ZBE3 (as used in other zebrafish protein studies) can be utilized . These cells provide an appropriate cellular context for investigating zebrafish protein interactions and functions. Additionally, U2OS cells stably expressing ER markers like Sec61α-RFP have been valuable for studying HERP protein localization within the ER network .

What analytical techniques are most effective for detecting herpud2 protein interactions?

Several complementary techniques have proven effective for investigating herpud2 protein interactions:

  • Co-immunoprecipitation (Co-IP): This technique has successfully demonstrated interactions between HERP proteins and other components of the ERAD machinery, such as HRD1, SEL1L, and DERL2 . For zebrafish herpud2, epitope tags such as Myc or Flag can be used for efficient immunoprecipitation.

  • His pull-down assays: This approach has been used to verify direct binding between proteins, such as the interaction demonstrated between TRIM25 and RIG-I in zebrafish . This methodology can be adapted for studying herpud2 interactions.

  • Immunofluorescence co-localization: This technique allows visualization of protein co-localization in cellular compartments, as demonstrated with HERP2 and ER markers .

  • Cell fractionation: This approach helps determine the subcellular localization of proteins, confirming membrane association versus cytosolic distribution .

These methods, often used in combination, provide robust evidence for protein-protein interactions and help elucidate the molecular complexes in which herpud2 participates.

How can CRISPR/Cas9 be optimized for generating zebrafish herpud2 knockout models?

For generating zebrafish herpud2 knockout models using CRISPR/Cas9, researchers should consider:

  • Guide RNA design: Target conserved functional domains such as the ubiquitin-like domain or the hydrophobic C-terminal region. Multiple guide RNAs should be designed and screened for efficacy, avoiding regions with high off-target potential.

  • Delivery method: Microinjection into fertilized zebrafish oocytes at the 1-2 cell stage using pulled glass capillaries and a microinjector, as described in zebrafish developmental studies .

  • Screening strategy: Employ T7 endonuclease assays or direct sequencing to identify mutations. Design primers that flank the target site for PCR amplification and subsequent analysis.

  • Confirmation of knockout: Validate the loss of herpud2 at both mRNA level (using qRT-PCR) and protein level (using Western blot with specific antibodies against zebrafish herpud2).

  • Phenotypic analysis: Assess developmental phenotypes, particularly focusing on tissues where herpud2 is expressed, such as skeletal muscle and potentially cardiac tissue based on its genomic proximity to Tbx20 .

What are the challenges in studying herpud2 function in zebrafish disease models?

Studying herpud2 in zebrafish disease models presents several challenges:

  • Functional redundancy: The partially redundant functions of HERP1 and HERP2 may mask phenotypes in single gene knockouts, necessitating double knockout or knockdown strategies .

  • Context-dependent effects: The function of herpud2 may vary across different tissues and developmental stages, requiring tissue-specific and temporally controlled gene manipulation strategies.

  • Substrate identification: Identifying specific ERAD substrates regulated by herpud2 in zebrafish requires comprehensive proteomics approaches and degradation assays.

  • Phenotypic assessment: Connecting molecular changes in ERAD function to observable phenotypes may require sensitive readouts of ER stress, protein aggregation, or tissue-specific dysfunctions.

  • Integration with human disease models: Translating findings from zebrafish to human disease contexts requires careful consideration of evolutionary conservation and potential differences in protein networks and regulation.

How can RNA-seq data analysis be applied to understand herpud2's role in zebrafish development and disease?

RNA-seq analysis can provide valuable insights into herpud2's role through:

  • Developmental expression profiling: Generating transcriptome data across developmental timepoints to map herpud2 expression dynamics in relation to developmental events.

  • Tissue-specific transcriptomics: Comparing expression patterns across different tissues to identify context-specific regulation and potential tissue-specific functions.

  • Differential expression in disease models: Similar to approaches used in zebrafish retinal degeneration models , RNA-seq can identify differentially expressed genes in herpud2 mutants compared to wild-type siblings.

  • Pathway analysis: Using tools like the PANTHER Classification System to identify biological processes and signaling pathways affected by herpud2 disruption .

  • Integration with other -omics data: Combining RNA-seq with proteomics data to correlate transcriptional changes with alterations in protein levels, particularly for ERAD substrates.

  • Cross-species comparative analysis: Comparing zebrafish herpud2-related transcriptional changes with mammalian models to identify conserved regulatory networks.

How can zebrafish herpud2 studies contribute to understanding human ERAD-related diseases?

Zebrafish herpud2 research can advance understanding of human ERAD-related diseases through:

  • Model system advantages: Zebrafish embryos offer transparency for imaging, rapid development, and genetic tractability , making them ideal for studying ERAD dysfunction in vivo.

  • Conservation of ERAD machinery: The core components of ERAD, including HERP proteins, are conserved between zebrafish and humans , suggesting functional insights may be translatable.

  • Disease modeling: Zebrafish models can recapitulate aspects of human diseases associated with ERAD dysfunction, such as neurodegenerative disorders characterized by protein aggregation.

  • Drug screening platform: The zebrafish system allows for medium-throughput screening of compounds that may modulate ERAD function, potentially identifying therapeutic candidates for ERAD-related diseases.

  • Tissue-specific ERAD regulation: Studies of herpud2 in specific zebrafish tissues, such as skeletal muscle , can inform understanding of tissue-specific ERAD regulation relevant to human muscular disorders.

What is the comparative analysis of herpud2 dysfunction across different vertebrate models?

A comparative analysis reveals:

  • Expression patterns: While mammalian studies show HERP2 is constitutively expressed , zebrafish herpud2 shows tissue-specific expression patterns, particularly in skeletal muscle with differential regulation during myotube differentiation .

  • Functional redundancy: Both mammalian and zebrafish studies demonstrate partial functional redundancy between HERP1 and HERP2, with simultaneous depletion causing more severe ERAD defects than individual knockdowns .

  • Stress response: Unlike HERP1, which is strongly induced by ER stress in both mammals and zebrafish, HERP2/herpud2 maintains relatively constant expression, suggesting an evolutionarily conserved distinction in stress responsiveness .

  • Developmental roles: Zebrafish studies have positioned herpud2 in proximity to developmental regulators like Tbx20 , suggesting potential developmental functions that may be explored in other vertebrate models.

  • Disease associations: While mammalian HERPUD2 has been studied in the context of neurogenic atrophy , zebrafish models may reveal additional roles in development-specific processes due to their advantageous characteristics for studying embryogenesis.

What are the most promising future research directions for zebrafish herpud2 studies?

Future research on zebrafish herpud2 should focus on:

  • Comprehensive developmental expression mapping: Generating detailed spatiotemporal expression data throughout zebrafish development using techniques like in situ hybridization and reporter constructs.

  • Tissue-specific conditional knockouts: Creating tissue-specific and inducible herpud2 knockout models to bypass potential early developmental lethality and study tissue-specific functions.

  • Identification of specific substrates: Using proteomics approaches to identify specific ERAD substrates regulated by herpud2 in different zebrafish tissues and developmental stages.

  • Structure-function analysis: Conducting domain-specific mutations to dissect the roles of different herpud2 protein regions in ERAD function and protein interactions.

  • Integration with human disease models: Establishing zebrafish models that mimic human diseases associated with ERAD dysfunction and testing whether herpud2 modulation affects disease progression.

  • High-resolution imaging: Applying advanced microscopy techniques to visualize herpud2-dependent ERAD processes in live zebrafish embryos, taking advantage of their transparency.

  • Drug discovery applications: Utilizing zebrafish herpud2 models for screening compounds that modulate ERAD function, potentially identifying therapeutic leads for ERAD-related diseases.

How can advances in proteomics enhance our understanding of herpud2 interactions in zebrafish?

Advanced proteomics approaches can revolutionize understanding of herpud2 through:

  • Proximity labeling techniques: BioID or APEX2 fusions with herpud2 can identify proximal interacting proteins in vivo in zebrafish.

  • Quantitative interaction proteomics: SILAC or TMT labeling coupled with immunoprecipitation can quantitatively compare herpud2 interactomes under different conditions.

  • Global proteome changes: Comparing proteome profiles between wild-type and herpud2-deficient zebrafish can reveal broader effects on cellular proteostasis.

  • Ubiquitinome analysis: Specialized proteomics to identify ubiquitinated substrates that accumulate in herpud2-deficient zebrafish, providing direct evidence of its ERAD targets.

  • Cross-linking mass spectrometry: This technique can capture transient interactions in the ERAD machinery, potentially identifying novel herpud2 partners.

  • Thermal proteome profiling: This approach can identify proteins whose stability is affected by herpud2 function, potentially revealing indirect effects on cellular proteostasis.

  • Spatial proteomics: Techniques that preserve spatial information while identifying protein interactions can map the ERAD network organization within the ER membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.