Recombinant Danio rerio Insulin-induced gene 1 protein (insig1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant insig1 is synthesized using heterologous expression systems:

  • Expression Systems:

    • E. coli: Cost-effective for large-scale production; yields insoluble protein requiring refolding .

    • Mammalian Cells (e.g., HEK293): Retains post-translational modifications and native folding .

  • Purification: Immunoaffinity or Ni-NTA chromatography for tagged variants .

Functional Role in Lipid Metabolism

Insig1 regulates cholesterol biosynthesis via two mechanisms:

  1. SCAP-SREBP Retention: Binds SCAP-SREBP complexes in the ER, blocking proteolytic activation of SREBP transcription factors .

  2. HMGCR Degradation: Recruits E3 ubiquitin ligases (e.g., TRC8) to degrade HMG-CoA reductase, a rate-limiting enzyme in cholesterol synthesis .

Key Findings:

  • Zebrafish insig1 shares 85% membrane domain homology with human INSIG1/2, enabling cross-species functional studies .

  • Asp-205 (zebrafish numbering) is critical for SCAP/HMGCR binding .

Applications in Virology

Insig1 inhibits HIV-1 replication by degrading the viral Gag protein via lysosomal pathways :

  • Mechanism: Partners with E3 ligase TRC8 to ubiquitinate Gag, targeting it for lysosomal degradation .

  • Experimental Evidence:

    • Overexpression reduces HIV-1 virion yield by 70% .

    • Knockout enhances viral production .

Research Tools and Reagents

  • Antibodies: Rabbit polyclonal antibodies against zebrafish insig1 are available for ELISA and Western blot .

  • Mutant Variants: Truncations of the KH motif or sterol-sensing domain are used to study functional domains .

Challenges and Considerations

  • Stability: Requires storage at -80°C for long-term preservation .

  • Species-Specificity: While structurally similar to mammalian INSIG1, zebrafish insig1 may exhibit functional divergences in lipid regulation .

Future Directions

  • Therapeutic Development: Targeting insig1-TRC8 interactions could yield antiviral therapies .

  • Lipid Disorder Models: Zebrafish insig1 mutants may elucidate mechanisms of hypercholesterolemia or fatty liver disease .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its inclusion.
Synonyms
insig1; Insulin-induced gene 1 protein; INSIG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
insig1
Target Protein Sequence
MPRLEEHCWSCSCSTSVKTKDLSSAGWIVCKTGEMMSIITSVLSHAYGSLHSLQSANLIR RGLVLFIVGVVLALVLNLLQIQRNVTLFPEEVLDTLFSSAWWIPLCCGTAAAVVGLLYPC LDHHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDR SRSGFGLGLTTALLATLIAQLLVYNGIYQYTSPDFLYVRSWLPCIFFSGGVTVGNIGRQL AMGSTEKIHND
Uniprot No.

Target Background

Function
Insulin-induced gene 1 protein (Insig1) is an oxysterol-binding protein that plays a crucial role in mediating feedback control of cholesterol synthesis. It regulates both endoplasmic reticulum (ER) to Golgi transport of Scap (SREBP cleavage-activating protein) and degradation of HMGCR (3-hydroxy-3-methylglutaryl-CoA reductase). Insig1 acts as a negative regulator of cholesterol biosynthesis by retaining the SCAP-SREBP complex in the ER, preventing the processing of sterol regulatory element-binding proteins (SREBPs). This interaction is modulated by the binding of oxysterols, such as 25-hydroxycholesterol, to Insig1. In the presence of oxysterols, Insig1 interacts with Scap, further reinforcing the retention of the SCAP-SREBP complex within the ER, thereby hindering SREBP transport to the Golgi. When sterol levels are depleted, oxysterol binding to Insig1 decreases, disrupting the Insig1-Scap interaction. This disruption promotes Golgi transport of the SCAP-SREBP complex, leading to the processing and nuclear translocation of SREBPs. Insig1 also contributes to regulating cholesterol synthesis by controlling the degradation of HMGCR.
Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of insig1 protein in Danio rerio?

Insulin-induced gene 1 protein (insig1) in zebrafish (Danio rerio) serves as an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. Similar to its mammalian counterpart, zebrafish insig1 contains transmembrane helices with effector protein binding sites that enable interaction with sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase). These interactions are essential for sterol-mediated trafficking of these proteins, which ultimately control cholesterol synthesis and metabolism .

How does zebrafish insig1 compare structurally to human insig1?

While the search results don't provide specific structural comparisons between zebrafish and human insig1, we can infer similarities based on data about the related insig2 protein. Insig-2 is 80% identical between zebrafish and humans, with most variations occurring in the hydrophilic NH2- and COOH-terminal sequences . This high conservation suggests that insig1 likely maintains significant structural homology between species as well, though possibly with less conservation than insig2, as insig2 is noted to be more highly conserved among vertebrate species than insig1 .

Which functional domains are critical for insig1 activity in zebrafish models?

The critical functional domains of zebrafish insig1 include its transmembrane helices that contain binding sites for SCAP and HMG-CoA reductase. These domains enable insig1 to mediate feedback control of cholesterol synthesis by controlling endoplasmic reticulum to Golgi transport of SCAP and degradation of HMG-CoA reductase . The protein's ability to bind oxysterols, including 25-hydroxycholesterol, is also crucial for regulating its interaction with SCAP and the retention of the SCAP-SREBP complex in the endoplasmic reticulum .

What are the optimal expression systems for producing recombinant Danio rerio insig1?

While the search results don't directly address expression systems for recombinant zebrafish insig1, researchers typically use bacterial systems (E. coli), yeast (Saccharomyces cerevisiae), insect cells (Sf9, Sf21), or mammalian cell lines (HEK293, CHO) for expressing recombinant proteins. For membrane proteins like insig1 that contain multiple transmembrane domains, eukaryotic expression systems such as insect cells or mammalian cells may provide better folding and post-translational modifications. When designing expression constructs, researchers should consider codon optimization for the expression host and include appropriate purification tags (His, FLAG, GST) that don't interfere with protein function .

How can I validate the functionality of recombinant zebrafish insig1 protein?

Functional validation of recombinant zebrafish insig1 can be accomplished through several complementary approaches:

  • Binding assays: Test the recombinant protein's ability to bind known partners like SCAP and HMG-CoA reductase using co-immunoprecipitation or pull-down assays.

  • Cholesterol regulation assays: Measure the protein's ability to regulate cholesterol synthesis in cellular systems, such as CHO cell lines (e.g., SRD-13A cells) .

  • Sterol-dependent retention assays: Assess whether the recombinant protein can mediate sterol-dependent retention of the SCAP/SREBP complex in the endoplasmic reticulum.

  • Rescue experiments: Test if the recombinant protein can restore normal function in insig1-deficient zebrafish or cell lines.

  • Oxysterol binding assays: Verify the protein's ability to bind oxysterols like 25-hydroxycholesterol .

What zebrafish developmental stages are best for studying insig1 function?

While the search results don't specifically address optimal developmental stages for studying insig1 in zebrafish, researchers typically work with embryos, larvae, and adult zebrafish depending on the research question. For developmental studies, researchers often observe zebrafish at specific hours post-fertilization (hpf): 24 hpf, 48 hpf, 72 hpf, and 96 hpf, as detailed in the zebrafish embryo development protocols . When studying the metabolism-related functions of insig1, larval stages may be particularly useful as demonstrated in insulin administration studies where human recombinant insulin was injected into the caudal aorta of zebrafish larvae .

How is insig1 involved in zebrafish models of diabetes and insulin resistance?

While the search results don't directly link insig1 to zebrafish diabetes models, they provide context for how such relationships might be studied. Zebrafish diabetes models, created through insulin administration or dietary manipulation, can be used to study how insig1 responds to altered metabolic states . In these models, researchers could examine changes in insig1 expression or function following hyperinsulinemia induction. The relationship between insulin signaling and insig1 could be studied by examining how hyperinsulinemic conditions (created by incubating larvae in high-insulin solutions) affect insig1-mediated regulation of lipid metabolism genes .

What is the role of recombinant insig1 in studying zebrafish lipid metabolism?

Recombinant insig1 protein can serve as a powerful tool for investigating zebrafish lipid metabolism through several experimental approaches:

  • In vitro binding studies to identify zebrafish-specific interacting partners in lipid metabolism pathways.

  • Structure-function analyses to determine how the protein regulates enzymes involved in lipid synthesis.

  • Reconstitution experiments in insig1-deficient systems to confirm direct effects on lipid metabolism.

  • Comparative studies between zebrafish and mammalian systems to identify conserved and divergent mechanisms of lipid regulation.

These approaches can help elucidate insig1's role in mediating feedback control of cholesterol synthesis by regulating SCAP transport and HMG-CoA reductase degradation in zebrafish .

How do changes in insig1 expression affect insulin-responsive genes in zebrafish?

While specific data on this relationship is not provided in the search results, we can infer from studies on insulin administration in zebrafish that potential connections exist. When human recombinant insulin was injected into zebrafish larvae, researchers observed downregulation of genes involved in insulin metabolism (insr, irs1, irs2, pik3cb) . By extension, investigating how insig1 manipulation affects these same genes could reveal important connections between insig1 function and insulin responsiveness. Researchers could use techniques like qPCR or RNA-seq to measure changes in insulin-responsive gene expression following insig1 overexpression or knockdown in zebrafish models .

What are the challenges of establishing zebrafish knockout models for insig1 research?

Creating effective zebrafish insig1 knockout models may present several challenges:

  • Potential functional redundancy between insig1 and the highly conserved insig2, which could mask phenotypes in single insig1 knockout models .

  • Possible developmental defects that might arise from early knockout if insig1 has essential roles in embryonic development.

  • The need to verify knockout efficiency at both the genomic DNA level (e.g., sequencing) and protein level (e.g., Western blot).

  • Addressing potential off-target effects when using CRISPR-Cas9 or other genome editing approaches.

  • Designing appropriate assays to detect subtle metabolic phenotypes that might result from insig1 knockout, especially in relation to cholesterol metabolism and insulin responsiveness.

Researchers should consider these challenges when designing knockout strategies and interpreting resulting phenotypes.

How can I design experiments to study the interaction between zebrafish insig1 and SREBP pathway components?

To study interactions between zebrafish insig1 and SREBP pathway components, consider the following experimental design approaches:

  • Co-immunoprecipitation assays using tagged recombinant proteins to identify direct binding partners.

  • FRET or BiFC assays to visualize protein-protein interactions in living cells.

  • Sterol depletion/loading experiments to determine how sterols affect the interaction between insig1 and SCAP in zebrafish cells.

  • Mutational analysis of the sterol-sensing domain of SCAP to identify residues critical for interaction with zebrafish insig1.

  • Subcellular localization studies using fluorescently tagged proteins to track SCAP/SREBP complex movement in the presence or absence of insig1 and sterols.

These approaches can help elucidate how zebrafish insig1 functions in the sterol-mediated retention of the SCAP/SREBP complex in the endoplasmic reticulum .

What confounding factors should I control for when studying recombinant insig1 in zebrafish diabetes models?

When studying recombinant insig1 in zebrafish diabetes models, researchers should control for several potential confounding factors:

  • Dietary composition differences: Standard zebrafish feed contains higher protein and lower carbohydrate levels compared to human diets, which affects insulin's role in glucose regulation and may influence insig1 function .

  • Developmental stage variations: The response to metabolic perturbations can vary significantly depending on the developmental stage of the zebrafish.

  • Method of diabetes induction: Different methods (genetic, chemical, dietary, or insulin injection) may affect insig1 function differently .

  • Expression level artifacts: Overexpression of recombinant insig1 may lead to non-physiological interactions or saturation of binding partners .

  • Endogenous insig1 and insig2 contributions: The presence of endogenous proteins may complicate interpretation of recombinant protein effects .

Controlling for these factors through appropriate experimental design and controls is essential for obtaining reliable and physiologically relevant results.

What are the key differences between recombinant zebrafish insig1 and insig2 proteins?

Based on the search results, we can identify several key differences between insig1 and insig2 proteins, though not all are specifically described for zebrafish:

  • Conservation level: Insig2 is more highly conserved among vertebrate species than insig1. Zebrafish and human insig2 share 80% sequence identity, while the conservation level for insig1 appears to be lower .

  • Structural differences: Most variations between these proteins occur in the hydrophilic NH2- and COOH-terminal sequences rather than in the transmembrane domains .

  • Regulatory mechanisms: Though not explicitly stated for zebrafish, in other systems insig1 and insig2 may have different expression patterns or responsiveness to metabolic stimuli.

These differences suggest that while both proteins may serve similar fundamental functions in cholesterol metabolism regulation, they likely have distinct roles or regulatory mechanisms that complement each other in maintaining metabolic homeostasis.

Table 1: Survival Rate Data from Zebrafish Embryo Development Studies

Concentration# of starting fish# alive 24 hpf# alive 48 hpf# alive 72 hpf# alive 96 hpf
Control4034282625
0.05 mg/mL4033302622
0.25 mg/mL4036353532
1 mg/mL403939150

Note: While this survival rate data is from a caffeine exposure study , similar experimental design could be applied to studies investigating the effects of recombinant insig1 protein on zebrafish development and metabolism.

What methods have been validated for studying insig1-mediated regulation in zebrafish models?

While the search results don't provide zebrafish-specific methods for studying insig1-mediated regulation, several approaches used in related research could be adapted:

  • Gene expression analysis: Monitoring the expression of phosphoenolpyruvate carboxykinase 1 (pck1) and other metabolism-related genes following manipulation of insig1 levels, similar to the approach used in insulin administration studies .

  • Protein-protein interaction assays: Studying the binding between insig1 and SCAP or HMG-CoA reductase using techniques like those applied to investigate insig2 function .

  • Subcellular localization studies: Tracking the movement of SCAP/SREBP complexes between the endoplasmic reticulum and Golgi in response to sterol levels and insig1 expression .

  • Metabolic assays: Measuring cholesterol synthesis, lipogenesis, and glucose metabolism in zebrafish with altered insig1 expression or activity.

  • Hyperinsulinemic zebrafish models: Using established methods for creating insulin resistance in zebrafish to study insig1's role in metabolic dysregulation .

How does recombinant insig1 protein administration affect zebrafish embryonic development?

Researchers would need to determine appropriate delivery methods (e.g., microinjection into embryos or addition to embryo media), concentrations, and timing of administration. Additionally, molecular markers of cholesterol metabolism, lipogenesis, and related developmental pathways should be monitored to understand the mechanistic basis of any observed developmental effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.