Recombinant Danio rerio Kynurenine 3-monooxygenase (kmo)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Kynurenine 3-Monooxygenase (KMO)

Recombinant Danio rerio Kynurenine 3-Monooxygenase (KMO) is a recombinant protein derived from zebrafish, expressed in Escherichia coli (E. coli). This enzyme plays a crucial role in the kynurenine pathway, which is involved in tryptophan metabolism. KMO catalyzes the conversion of L-kynurenine to 3-hydroxykynurenine, a step that is significant in various biological processes, including neurodegenerative diseases and immune responses.

Characteristics of Recombinant Danio rerio KMO

The recombinant full-length Danio rerio KMO protein is His-tagged and consists of 474 amino acids (1-474aa). It is expressed in E. coli and available in a lyophilized powder form. The protein has a purity of greater than 90% as determined by SDS-PAGE. Storage recommendations include maintaining it at -20°C or -80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles .

Biological Function of KMO

KMO is a key enzyme in the kynurenine pathway, which is involved in the breakdown of tryptophan. This pathway is crucial for various physiological processes and has been implicated in neurodegenerative diseases, cancer, and immune responses. The enzyme catalyzes the conversion of L-kynurenine to 3-hydroxykynurenine, which can further metabolize into quinolinic acid, a compound with neurotoxic properties .

Research Findings and Applications

Recent studies have highlighted the potential antiviral properties of KMO and its metabolites. For instance, quinolinic acid, a downstream product of KMO activity, has been shown to induce type I interferon production, thereby exerting broad-spectrum antiviral effects . While specific research on the recombinant Danio rerio KMO is limited, its role in tryptophan metabolism and potential applications in antiviral therapy make it an interesting subject for further investigation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kmo; zgc:136684; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-474
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
kmo
Target Protein Sequence
METAFSHPPQSSSSKRKVIAVVGGGLVGSLNACFLAKRGFDVEVYESREDIRQAKVVKGR SINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHNVNGKRSPIPYGKKGQYILSVDRA NLNKELLTAAEAYPNTRLNFNHKLHDWSPKTGTMTFIGSDGQKTETQADLIVGCDGAFSA VRKQFLRQSRFNYSQTYIPHGYMELTMPPKDGDFAMEPNYLHIWPRNTFMMIALPNLDRT FTCTLFMPFEDFEKIRTGDELLRFFHKYFPDSVPLIGVEALKQDFFRLPAQAMVSVKCCP YHLFEKCVLMGDAAHAVVPFYGQGMNAGFEDCLVFDEIMDQFNENLVAVLQEYTRVRVPD DHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPKTIVPLYTMVTFTRTRYNDAV NRWHWQNKVITRGLWLCGFVSAAGGTYVLVKNSHKLPSISAEQLWTRILALKLF
Uniprot No.

Target Background

Function

Function: Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). This enzyme is essential for quinolinic acid biosynthesis.

Database Links
Protein Families
Aromatic-ring hydroxylase family, KMO subfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.