Recombinant Danio rerio Leucine-rich repeat-containing protein 3B (lrrc3b)

Shipped with Ice Packs
In Stock

Description

General Information

CharacteristicDescription
Product CodeCSB-CF013137DIL
UniProt No.A3KNN3
Synonymslrrc3b; zgc:162270; Leucine-rich repeat-containing protein 3B
SourceE. coli
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull Length of Mature Protein (34-258 aa)
Molecular WeightPredicted molecular weight of 26.9 kDa
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
Immunogen SpeciesDanio rerio (Zebrafish) (Brachydanio rerio)
Expression Region34-258
Amino Acid SequenceCPKGCTCQRSESPPHGLNVTCSLSRLKEIPPDVPPDTQLLQLDRNHISLVPDRIFHGLRM LRRLNLSHNAVETLGEGAFIGLEGSLEVLDLSYNRITSVHKDAFARLKARVVVDNNPWHC DCALQQALGGMAHNHERVLCRSSELRDQEGQPFMAVDADLCNLAKRTTDYAMLVTMFGWF AMVISYVVYYVRQNQEDARRHLEYLKSLPSKPKKPDEPEDISTVV
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃
StorageStore at -20°C/-80°C; avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended NameLeucine-rich repeat-containing protein 3B
Product TypeTransmembrane Protein

Biological significance of LRRs

Leucine-rich repeat (LRR) motifs are structural motifs of 20-30 amino acids in length that are involved in protein-protein interactions . These motifs are characterized by the presence of conserved leucine residues and are often found in proteins involved in innate immunity and signal transduction. LRR proteins are involved in a variety of biological processes, including:

  • Immune response Some LRR proteins recognize pathogen-associated molecular patterns (PAMPs) and activate the innate immune response .

  • Signal transduction Other LRR proteins are involved in signal transduction pathways, where they mediate protein-protein interactions that regulate cell growth, differentiation, and apoptosis .

  • Development LRR proteins also play a role in development, where they are involved in cell adhesion, migration, and differentiation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
lrrc3b; zgc:162270; Leucine-rich repeat-containing protein 3B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-258
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
lrrc3b
Target Protein Sequence
CPKGCTCQRSESPPHGLNVTCSLSRLKEIPPDVPPDTQLLQLDRNHISLVPDRIFHGLRM LRRLNLSHNAVETLGEGAFIGLEGSLEVLDLSYNRITSVHKDAFARLKARVVVDNNPWHC DCALQQALGGMAHNHERVLCRSSELRDQEGQPFMAVDADLCNLAKRTTDYAMLVTMFGWF AMVISYVVYYVRQNQEDARRHLEYLKSLPSKPKKPDEPEDISTVV
Uniprot No.

Target Background

Database Links
Protein Families
LRRC3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant lrrc3b protein?

For optimal stability and activity preservation of recombinant Danio rerio lrrc3b protein, follow these evidence-based protocols:

  • Short-term storage: Keep working aliquots at 4°C for no more than one week to maintain activity .

  • Medium-term storage: Store at -20°C in single-use aliquots containing Tris-based buffer with 50% glycerol .

  • Long-term storage: For extended preservation, maintain at -80°C in the same buffer composition .

  • Handling recommendations:

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • Thaw aliquots on ice

    • Centrifuge briefly before opening tubes to collect condensation

    • Use siliconized tubes for dilutions to prevent protein adhesion

When designing experiments, account for potential activity loss after each freeze-thaw cycle (approximately 10-15% per cycle based on studies with similar proteins).

How can developmental expression patterns of lrrc genes in zebrafish be characterized?

Based on methodologies used with related lrrc family members, the following approaches are recommended for characterizing lrrc3b expression patterns:

Temporal expression analysis:

  • RT-PCR: Collect embryos at key developmental timepoints (e.g., 0, 3, 6, 12, 24, 48, and 72 hpf) and perform RT-PCR with gene-specific primers, using actb1 (β-actin) as a loading control .

  • qPCR: For quantitative assessment of expression levels across developmental stages.

Spatial expression analysis:

  • Whole-mount in situ hybridization (WISH): Generate antisense RNA probes specific to lrrc3b and perform WISH on fixed embryos at different developmental stages to visualize tissue-specific expression patterns .

Integration of expression data:
Compile a comprehensive expression profile table like this:

Developmental StageRT-PCR DetectionPrimary Expression DomainsExpression Level (relative)
0 hpf (zygote)Present/Absent[tissues]High/Medium/Low
3 hpf (blastula)Present/Absent[tissues]High/Medium/Low
6 hpf (gastrula)Present/Absent[tissues]High/Medium/Low
12 hpf (segmentation)Present/Absent[tissues]High/Medium/Low
24 hpf (pharyngula)Present/Absent[tissues]High/Medium/Low
48 hpf (hatching)Present/Absent[tissues]High/Medium/Low
72 hpf (larval)Present/Absent[tissues]High/Medium/Low

Studies on related lrrc8 genes indicate they are often ubiquitously expressed in early embryogenesis and become restricted to specific tissues like neural tubes and cardiogenic regions by 24 hpf .

What considerations should guide experimental design when studying lrrc3b function in zebrafish embryos?

When designing experiments to study lrrc3b function in zebrafish embryos, implement these methodological approaches for robust results:

1. Temporal considerations:

  • Based on related lrrc family gene expression patterns, focus observations on key developmental windows:

    • Early development (0-12 hpf) for potential maternal contribution effects

    • Mid-development (12-24 hpf) for neurulation and early organogenesis

    • Later development (24-72 hpf) for specific organ system formation

2. Knockdown/knockout design strategies:

  • Morpholino approach:

    • Design both splice-blocking (e.g., exon-intron boundary targeting) and translation-blocking morpholinos targeting lrrc3b

    • Include standard control morpholinos

    • Confirm knockdown efficiency by RT-PCR for splice-blocking morpholinos or Western blot for translation-blocking morpholinos

    • Use 1-4 ng per embryo as typical starting concentrations

  • CRISPR/Cas9 approach:

    • Design guide RNAs targeting early exons

    • For temporary knockdown, consider CRISPR interference rather than complete knockout

    • Validate editing efficiency using T7 endonuclease assay or direct sequencing

3. Phenotypic assessment timeline:
Based on studies of related lrrc8 genes, implement this assessment schedule:

Developmental StagePrimary AssessmentsSecondary Assessments
24 hpfBrain ventricle formation, Neural tube developmentHeart morphology, Circulation
32 hpfCirculatory system function, Heart rateBrain ventricle size, Body axis
48-72 hpfOrgan-specific functions, Behavioral assessmentsHistological analysis

4. Rescue experiments:

  • Prepare capped mRNA of lrrc3b for co-injection with morpholinos

  • Test paralogous genes for functional redundancy

  • Consider taurine supplementation in E3 medium based on rescue effects seen with related lrrc genes

How can morpholino knockdown techniques be optimized for studying lrrc3b?

Optimizing morpholino knockdown for lrrc3b requires a systematic approach to ensure specificity and minimize off-target effects:

1. Morpholino design strategy:

  • Design two independent morpholinos:

    • Translation-blocking morpholino (TB-MO): Target the region spanning the AUG start codon

    • Splice-blocking morpholino (SB-MO): Target exon-intron boundaries, preferably exon 2-intron 2 junction based on successful approaches with related lrrc genes

2. Validation protocol:

  • For SB-MO: Perform RT-PCR using primers flanking the targeted splice site (e.g., exon 1 to 3)

  • For TB-MO: Western blot analysis using lrrc3b-specific antibodies

  • Include standard control morpholino at equivalent concentrations

  • Document dose-dependency of phenotypes with 2-3 different concentrations

3. Phenotype assessment workflow:

  • Document morphological changes using brightfield microscopy

  • For brain ventricle assessment, inject fluorescent TRITC-dextran (20 mg/ml) into the fourth brain ventricle at 24 hpf and measure ventricular areas using ImageJ

  • For circulatory assessment, perform microangiography at 32 hpf

  • Classify phenotypes into categories: wild-type, mild, moderate, severe

4. Rescue experiment design:

  • Co-inject lrrc3b mRNA (100-200 pg) with morpholinos

  • Test rescue with paralogous gene mRNAs

  • Prepare taurine supplementation in E3 medium (0.4 mM) based on successful rescue of related lrrc8 morphants

  • Calculate and report rescue efficiency percentages

5. Common technical challenges and solutions:

  • High mortality: Reduce MO concentration or co-inject p53 MO to reduce off-target effects

  • Inconsistent knockdown: Ensure proper MO aliquoting and storage at -20°C

  • Non-specific effects: Always compare with standard control MO and perform rescue experiments

What CRISPR/Cas9 strategies are most effective for functional studies of lrrc3b?

For CRISPR/Cas9-mediated functional studies of lrrc3b, implement these evidence-based strategies:

1. Guide RNA design approach:

  • Target early exons (preferably exon 1 or 2) to ensure functional disruption

  • Design at least three independent gRNAs

  • Preferred target: sequences immediately following the start codon

  • Avoid regions with high GC content or repetitive sequences

  • Scan for potential off-target sites using tools like CHOPCHOP or CRISPOR

2. CRISPR delivery methods:

  • Standard knockout approach: Inject Cas9 protein (500-1000 ng/μl) with gRNA (50-100 ng/μl)

  • CRISPR interference (CRISPRi): Use dCas9 fused to repressors for temporary knockdown, shown effective in zebrafish studies

  • Conditional approaches: Consider heat-shock inducible Cas9 systems for temporal control

3. Validation protocol:

  • T7 endonuclease assay on F0 embryos to confirm targeting

  • Direct sequencing of target region from pooled embryos

  • For F1 screening, design genotyping primers flanking the target site

4. Working with functional domains:
This strategy targets specific functional domains rather than creating null alleles:

Functional DomainExon LocationTargeting StrategyExpected Effect
Leucine-rich repeatMiddle exonsIn-frame deletionDisruption of protein-protein interactions
Transmembrane domainLater exonsFrameshift mutationAltered membrane localization
Signal peptideEarly exonSmall deletionSecretion/localization defects

5. Phenotyping approaches:

  • Use Q-STARZ (Quantitative Spatial and Temporal Assessment of Regulatory element activity in Zebrafish) for detailed phenotypic assessment

  • Implement dual-fluorescent reporter systems for simultaneous visualization of wild-type and mutant phenotypes

  • Document phenotypes at 24, 32, 48, and 72 hpf based on known developmental roles of related lrrc proteins

How can the functional relationship between lrrc3b and other leucine-rich repeat proteins in zebrafish development be determined?

Determining functional relationships between lrrc3b and other leucine-rich repeat proteins requires a multi-faceted approach:

1. Comparative expression analysis:

  • Perform systematic RT-PCR or qPCR analysis of all lrrc family members across developmental stages (0-72 hpf)

  • Create an expression matrix showing temporal patterns

  • Conduct WISH to identify spatial expression pattern overlaps

Example comparative expression pattern (based on related lrrc8 genes):

Gene0 hpf6 hpf12 hpf24 hpf48 hpf72 hpfPrimary Expression Domains at 24 hpf
lrrc3b+/-+/-+/-+/-+/-+/-[to be determined]
lrrc8aa+++++++++++++++Neural tube, cardiogenic region
lrrc8ab++++++++++++Neural tube, cardiogenic region
lrrc8c++++++++++++++++++[based on related genes]
lrrc8da--+++++++[based on related genes]
lrrc8db--+++++++[based on related genes]

2. Functional redundancy testing:

  • Generate single gene knockdowns/knockouts of each lrrc gene

  • Create double (or multiple) knockdowns/knockouts

  • Perform rescue experiments using mRNA from each family member

  • Document phenotypic severity differences and rescue efficiencies

3. Protein interaction studies:

  • Conduct co-immunoprecipitation assays with tagged versions of lrrc proteins

  • Implement proximity ligation assays in zebrafish embryos

  • Perform yeast two-hybrid screens to identify potential interacting partners

4. Transcriptomic analysis following perturbation:

  • Compare RNA-seq data from control and lrrc3b-depleted embryos

  • Analyze changes in expression of other lrrc family members

  • Identify commonly affected pathways across different lrrc knockdowns

5. Functional pathway analysis:
Studies of lrrc8a paralogs suggest potential roles in:

  • Brain ventricle formation

  • Circulatory system development

  • Cellular volume regulation

  • Taurine transport pathways

These pathways may provide starting points for investigating lrrc3b function.

What approaches can determine if lrrc3b participates in brain ventricle morphogenesis similar to lrrc8 proteins?

Based on findings that lrrc8a paralogs contribute to brain ventricle morphogenesis , the following methodological approach can determine if lrrc3b has similar functions:

1. Ventricle morphology assessment protocol:

  • Generate lrrc3b knockdown/knockout models using optimized morpholinos or CRISPR/Cas9

  • At 24 hpf, inject fluorescent TRITC-dextran (20 mg/ml) into the fourth brain ventricle of live non-monstrous embryos

  • Capture overlaid micrographic images of ventricles

  • Measure and quantify the area representing the diencephalic/mesencephalic ventricle (DMv) using ImageJ

  • Compare measurements between control and lrrc3b-depleted embryos

2. Comparative analysis framework:

  • Conduct parallel knockdowns of lrrc3b and lrrc8 paralogs

  • Create a phenotypic comparison table:

ConditionBrain Ventricle Area (µm²)% Reduction vs ControlCirculation Defects (%)Rescue with lrrc3b mRNA (%)
Control MO[baseline]0%[baseline]N/A
lrrc3b MO[to be determined][%][%][%]
lrrc8aa MO[from literature][%][%][%]
lrrc8ab MO[from literature][%][%][%]
Double knockdown[to be determined][%][%][%]

3. Temporal developmental assessment:

  • Monitor ventricle formation at multiple timepoints (18, 24, 30, 36 hpf)

  • Document both size and morphological changes

  • Create time-lapse imaging of ventricle development in control vs knockdown embryos

4. Cellular mechanism investigation:

  • Perform TUNEL assays to detect apoptosis in ventricular regions

  • Use EdU incorporation to assess proliferation differences

  • Examine cell junctions and polarity markers in ventricular cells

  • Assess F-actin distribution to evaluate cytoskeletal organization

5. Rescue experiment design:

  • Test taurine supplementation (0.4 mM in E3 medium) which rescues lrrc8a morphants

  • Overexpress csad mRNA which also rescues lrrc8a morphants

  • Perform cross-rescue experiments with lrrc8aa and lrrc8ab mRNAs

  • Document rescue efficiencies for each approach

6. Volume regulation testing:

  • Expose embryos to hypotonic and hypertonic conditions

  • Assess ventricle size changes under osmotic stress

  • Compare responses between control and lrrc3b-depleted embryos

What methodologies can determine the involvement of lrrc3b in zebrafish circulatory system development?

To investigate potential roles of lrrc3b in circulatory system development (as suggested by studies of related lrrc8 genes ), implement this systematic approach:

1. Circulatory phenotype assessment protocol:

  • Generate lrrc3b knockdown models using validated morpholinos or CRISPR/Cas9

  • Observe circulation in live embryos at 28-32 hpf when circulation is well-established

  • Perform microangiography by injecting fluorescent TRITC-dextran into the sinus venosus

  • Document flow rates, vessel morphology, and cardiac function

2. Quantitative circulatory parameters to measure:

  • Heart rate (beats per minute)

  • Blood flow velocity in major vessels (μm/s)

  • Vessel diameter (μm)

  • Cardiac output (nl/min)

  • Presence/absence of circulation in specific vascular beds

3. Timeline for comprehensive circulatory assessment:

Developmental StagePrimary AssessmentSecondary AssessmentControls
24 hpfHeart tube formation, Initial contractionsPrimitive vessel formationStandard control MO, uninjected
28 hpfBlood circulation initiationHeart looping completionStandard control MO, uninjected
32 hpfEstablished circulationHeart chamber developmentStandard control MO, uninjected
48 hpfMature circulationFunctional assessmentStandard control MO, uninjected
72 hpfAngiogenic sproutingVascular bed expansionStandard control MO, uninjected

4. Molecular marker analysis:

  • Perform WISH with cardiac markers (nkx2.5, cmlc2)

  • Assess vascular markers (flk1, fli1a)

  • Examine blood cell markers (gata1, pu.1)

  • Create transgenic reporters in lrrc3b knockout background

5. Functional testing methodology:

  • Response to cardiac stress using terfenadine or similar compounds

  • Recovery assessment following hypoxic challenge

  • Vascular integrity testing using extravasation assays

  • Heart function assessment using high-speed imaging

6. Cell-autonomous vs. non-cell-autonomous effects:

  • Generate tissue-specific CRISPR knockouts using appropriate promoters

  • Perform cell transplantation experiments between wild-type and lrrc3b-deficient embryos

  • Track labeled donor cells to determine if effects are cell-autonomous

How can regulatory elements affecting lrrc3b expression be identified and characterized?

The Q-STARZ (Quantitative Spatial and Temporal Assessment of Regulatory element activity in Zebrafish) method provides an advanced approach for identifying and characterizing regulatory elements affecting lrrc3b expression:

1. Identification of candidate regulatory elements:

  • Perform computational analysis of genomic regions surrounding lrrc3b

  • Look for evolutionarily conserved non-coding elements

  • Identify regions with chromatin signatures associated with enhancers (H3K27ac, H3K4me1)

  • Examine ATAC-seq data for accessible chromatin regions

2. Implementation of Q-STARZ methodology:
This dual-CRE dual-reporter approach allows simultaneous assessment of wild-type and mutant regulatory elements:

  • Generate "landing lines" with phiC31 attB integration sites at inert positions in the zebrafish genome

  • Create a dual-CRE dual-reporter cassette containing:

    • Wild-type candidate regulatory element driving eGFP expression

    • Mutated regulatory element driving mCherry expression

    • Strong insulator sequences between constructs

  • Integrate the cassette into the predefined genomic site

3. Quantitative analysis procedure:

  • Perform live imaging of transgenic embryos at multiple developmental stages

  • Quantify eGFP and mCherry fluorescence to compare wild-type vs. mutant element activity

  • Create spatial activity maps showing where and when each element is active

  • Analyze temporal dynamics of regulatory element activity

4. Validating regulatory element-target gene relationships:

  • Implement CRISPR/Cas9 deletion of candidate elements in their endogenous context

  • Assess effects on lrrc3b expression using qPCR and WISH

  • Perform chromosome conformation capture (4C or Hi-C) to verify physical interactions

5. Transcription factor binding site analysis:

  • Identify potential TF binding sites within regulatory elements using motif analysis

  • Test functionality through site-directed mutagenesis

  • Validate TF-element interactions using ChIP-qPCR

  • Perform TF knockdown to assess effects on enhancer activity

6. Disease-associated variant analysis:
This approach can be extended to study the impact of genetic variants:

  • Compare wild-type and variant-containing regulatory elements in the same developing embryo

  • Directly visualize spatial and temporal differences in activity

  • Quantify the functional impact of genetic variants on enhancer function

What approaches can characterize potential paralogous relationships between lrrc3b and other leucine-rich repeat family members?

Characterizing paralogous relationships between lrrc3b and other LRR family members requires a comprehensive evolutionary and functional genomics approach:

1. Comparative genomic analysis protocol:

  • Perform phylogenetic analysis of all lrrc family members in zebrafish

  • Compare with human and mouse orthologs to identify evolutionary relationships

  • Analyze syntenic relationships to identify potential whole-genome duplication-derived paralogs

  • Calculate sequence conservation percentages across functional domains

2. Protein domain architecture comparison:

  • Analyze conservation of leucine-rich repeat motifs

  • Compare transmembrane regions and other functional domains

  • Create domain conservation heat map across family members:

GeneLRR Domain 1 conservationLRR Domain 2 conservationTransmembrane DomainC-terminal Domain
lrrc3b[reference][reference][reference][reference]
lrrc8aa[% identity][% identity][% identity][% identity]
lrrc8ab[% identity][% identity][% identity][% identity]
lrrc8c[% identity][% identity][% identity][% identity]
Other family members[% identity][% identity][% identity][% identity]

3. Functional complementation analysis:

  • Design rescue experiments where lrrc3b mRNA is injected into morphants/mutants of other lrrc family members

  • Test if other lrrc family member mRNAs can rescue lrrc3b depletion

  • Create chimeric proteins swapping functional domains between family members

  • Quantify rescue efficiency percentages

4. Expression pattern comparative analysis:

  • Document comparative expression using dual-color WISH

  • Perform single-cell RNA-seq to identify co-expression at cellular resolution

  • Create expression correlation matrices across developmental stages

5. Shared molecular function assessment:

  • Test involvement in volume regulation (known function of lrrc8 proteins)

  • Assess potential roles in taurine transport

  • Investigate ion channel formation capabilities

  • Examine protein-protein interaction networks

This multifaceted approach will provide robust evidence for functional and evolutionary relationships between lrrc3b and other family members, helping to elucidate potential compensatory mechanisms and functional redundancies.

How can advanced imaging techniques be optimized for studying lrrc3b localization and function in live zebrafish embryos?

Optimizing advanced imaging techniques for studying lrrc3b requires specialized approaches to visualize protein localization and dynamics in live embryos:

1. Fluorescent fusion protein strategy:

  • Create lrrc3b-fluorescent protein fusions (GFP, mCherry, mScarlet)

  • Compare N-terminal vs. C-terminal tagging to determine optimal configuration

  • Validate fusion protein functionality through rescue experiments

  • Implement conditional expression systems (heat-shock, Gal4/UAS) for temporal control

2. Multi-modal imaging workflow:

  • Confocal microscopy: For high-resolution subcellular localization

    • Protocol: Z-stack acquisition at 0.5-1 μm steps

    • Analysis: 3D reconstruction of expression domains

  • Light-sheet microscopy: For long-term time-lapse with minimal phototoxicity

    • Protocol: Volumetric imaging at 5-10 minute intervals for 12+ hours

    • Analysis: Cell tracking and lineage tracing in lrrc3b-expressing regions

  • Super-resolution microscopy: For nanoscale organization

    • Protocol: STED or PALM imaging of specific structures

    • Analysis: Nanodomain organization and clustering

3. Dynamic analyses to implement:

  • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

  • Proximity ligation assays to visualize protein-protein interactions in situ

  • Optogenetic approaches to manipulate lrrc3b function with spatiotemporal precision

  • Biosensor integration to monitor associated signaling activities

4. Correlative imaging approach:
For comprehensive structure-function analysis:

  • Implement imaging at multiple scales (tissue → cellular → subcellular)

  • Combine live imaging with post-fixation immunohistochemistry

  • Correlate functional readouts with protein localization

5. Quantitative image analysis pipeline:

  • Segment cells/tissues expressing lrrc3b

  • Track dynamic changes in subcellular localization

  • Measure correlation with functional readouts (e.g., ventricle size)

  • Generate quantitative heatmaps of protein distribution

6. Technical optimization table:

ParameterConfocal SettingsLight-sheet SettingsSuper-resolution Settings
Laser power5-15%1-5%10-30%
Exposure time50-200 ms20-50 ms5-20 ms (STED)
Z-step size0.5-1 μm1-2 μm0.1-0.2 μm
Time interval5-15 min1-5 minN/A (fixed)
Sample preparationAgarose mountingAgarose cylinderCover glass mounting
Anesthesia0.016% tricaine0.016% tricaineN/A (fixed)

What strategies can overcome challenges in generating specific antibodies against zebrafish lrrc3b?

Generating specific antibodies against zebrafish lrrc3b presents several challenges that can be addressed with these methodological solutions:

1. Antigen design optimization:

  • Perform in silico analysis to identify unique, surface-exposed epitopes

  • Select regions with:

    • Low sequence similarity to other lrrc family members

    • High predicted antigenicity

    • Minimal post-translational modifications

  • Consider these multiple antigen approaches:

Antigen TypeSequence RegionAdvantagesChallenges
Synthetic peptideN-terminal (aa 34-50)High specificityLimited epitopes
Synthetic peptideMiddle region (aa 120-135)Unique to lrrc3bPotential conformational issues
Recombinant fragmentLarger region (aa 34-150)Multiple epitopesMore cross-reactivity
Full-length proteinComplete sequenceComplete antigenicityHighest cross-reactivity risk

2. Antibody production protocol:

  • Generate antibodies in two different host species (rabbit and guinea pig)

  • Implement dual-purification strategy:

    • Affinity purification against the immunizing antigen

    • Negative selection against closely related family members

  • Test multiple immunization protocols (standard vs. extended)

3. Validation workflow:

  • Western blot analysis using:

    • Wild-type vs. lrrc3b knockdown/knockout samples

    • Tissues with known expression vs. negative control tissues

    • Preincubation with immunizing peptide (blocking control)

  • Immunohistochemistry validation:

    • Compare with mRNA expression pattern by WISH

    • Test on transgenic lines with tagged lrrc3b

    • Include knockout/knockdown tissues as negative controls

4. Cross-reactivity mitigation strategies:

  • Perform cross-adsorption against recombinant proteins of closely related family members

  • Employ epitope-specific antibodies targeting unique regions

  • Use competitive ELISA to assess binding specificity

5. Alternative approaches when antibodies fail:

  • CRISPR knock-in of small epitope tags (FLAG, HA, V5)

  • Generation of transgenic lines expressing lrrc3b-fluorescent protein fusions

  • Proximity labeling approaches (BioID, APEX) to identify interacting proteins

How can researchers distinguish between specific and non-specific phenotypes in lrrc3b functional studies?

Distinguishing specific from non-specific phenotypes in lrrc3b studies requires a systematic validation approach:

1. Comprehensive control framework:

  • Implement a multi-level control system:

    • Standard control morpholino/gRNA injections

    • Dose-response analysis (titration of knockdown reagents)

    • p53 morpholino co-injection to control for off-target effects

    • Multiple independent targeting strategies (different MOs or gRNAs)

2. Rescue experiment design:

  • Perform rescue with wild-type lrrc3b mRNA

  • Test rescue with mRNA containing silent mutations to prevent morpholino binding

  • Create a rescue efficiency quantification table:

Phenotype CategoryControl MO (%)lrrc3b MO (%)lrrc3b MO + WT mRNA (%)p-value
Normal[baseline][reduced %][rescue %][stat]
Mild defects[baseline][increased %][rescue %][stat]
Moderate defects[baseline][increased %][rescue %][stat]
Severe defects[baseline][increased %][rescue %][stat]
Death[baseline][increased %][rescue %][stat]

3. Genetic validation approach:

  • Generate stable mutant lines using CRISPR/Cas9

  • Compare morphant and mutant phenotypes

  • Analyze F2 homozygous mutants to eliminate maternal contribution effects

  • Implement genetic complementation tests with other related gene mutants

4. Molecular validation strategy:

  • Verify target gene knockdown efficiency by RT-PCR/qPCR

  • Perform RNA-seq to identify off-target effects

  • Use ChIP-seq or CUT&RUN to identify potential direct targets

  • Document phenotype penetrance and expressivity

5. Tissue-specific knockdown/rescue:

  • Implement tissue-specific gene disruption using:

    • Cell-type specific CRISPR (e.g., brain-specific promoters)

    • Cre-lox conditional approaches

    • Tissue-specific rescue in global knockouts

  • Compare tissue-specific vs. global phenotypes

6. Temporal validation:

  • Use heat-shock inducible approaches for temporal control

  • Implement photoactivatable morpholinos for stage-specific knockdown

  • Document phenotypic outcomes at multiple developmental stages

  • Create temporal phenotype progression maps

What methodological approaches can resolve data inconsistencies in lrrc3b studies across different zebrafish strains?

Resolving data inconsistencies across different zebrafish strains requires systematic methodological approaches:

1. Strain-specific baseline characterization:

  • Perform comparative analysis of lrrc3b expression across common laboratory strains:

    • AB

    • Tübingen

    • TL (Tupfel long fin)

    • WIK

    • Casper

  • Document strain-specific variations in:

    • Developmental timing

    • Expression levels

    • Background phenotypes

2. Strain compatibility testing protocol:

  • Test knockdown/knockout efficiency in multiple strains

  • Create a strain response matrix:

Experimental ApproachAB StrainTL StrainTübingen StrainWIK Strain
lrrc3b MO (3 ng)[phenotype %][phenotype %][phenotype %][phenotype %]
lrrc3b MO (5 ng)[phenotype %][phenotype %][phenotype %][phenotype %]
lrrc3b CRISPR gRNA1[phenotype %][phenotype %][phenotype %][phenotype %]
lrrc3b CRISPR gRNA2[phenotype %][phenotype %][phenotype %][phenotype %]
lrrc3b mRNA (100 pg)[phenotype %][phenotype %][phenotype %][phenotype %]
lrrc3b mRNA (200 pg)[phenotype %][phenotype %][phenotype %][phenotype %]

3. Genetic background normalization approaches:

  • Outcross mutant lines to different wild-type strains

  • Backcross for multiple generations to standardize genetic background

  • Implement incross breeding strategy to minimize heterogeneity

  • Create isogenic lines through gynogenesis

4. Standardized phenotyping methodology:

  • Develop quantitative phenotyping protocols:

    • Automated image analysis for morphological features

    • Standardized scoring systems for categorical phenotypes

    • Blinded assessment by multiple researchers

  • Document inter-observer and intra-observer variability

5. Meta-analysis approach for reconciling inconsistencies:

  • Perform statistical integration of data across multiple studies

  • Implement random-effects models to account for strain differences

  • Calculate confidence intervals for phenotypic outcomes

  • Identify consistent vs. strain-dependent phenotypes

6. Data reporting standards:

  • Always document:

    • Specific strain used

    • Generation number

    • Source facility

    • Maintenance conditions

    • Age-matched controls from same facility

  • Report raw data alongside processed results

  • Include negative results and strain-specific limitations

By implementing these systematic approaches, researchers can resolve inconsistencies and establish which phenotypes are robustly associated with lrrc3b across genetic backgrounds versus those that are strain-dependent.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.