Recombinant Danio rerio Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (lrit2)

Shipped with Ice Packs
In Stock

Description

Introduction

Leucine-rich repeat, immunoglobulin-like domain, and transmembrane domain-containing protein 2 (Lrit2) is a protein that, in Danio rerio (zebrafish), is associated with the cell membrane . It contains leucine-rich repeats, an immunoglobulin-like domain, and a transmembrane domain .

General Information

FeatureDescription
NameLeucine-rich repeat, Ig-like and transmembrane domains 2
SymbolLrit2
OrganismDanio rerio (Zebrafish)
LocationCell membrane
DomainsLeucine-rich repeat, Immunoglobulin-like domain, Transmembrane domain

Expression and Localization

Lrit2 is predicted to be located in the membrane . The specific tissues and developmental stages where Lrit2 is expressed in Danio rerio could give clues as to its function, but more experimental data is necessary .

Potential Functions and Significance

Due to its structural characteristics, Lrit2 may be involved in cell adhesion, receptor signaling, or other processes that require interaction with other proteins or molecules on the cell surface . Further research is needed to fully elucidate the functions of Lrit2 in Danio rerio.

Research and Studies

As a member of the Ly6 gene cluster, recombinant forms of proteins similar to Lrit2 have demonstrated antimicrobial activity in Danio rerio . Further studies could explore whether Lrit2 possesses similar properties or plays a role in the immune response of zebrafish.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
lrit2; zgc:109962; Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-561
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
lrit2
Target Protein Sequence
ECFPGCSCGTDRHGRSLTCMETALTGIPDGLPEDLTKIRIEKSQLSELPEAVFSHVKALK HLWLNFNDIAIINIKSLEGLANLTELRLQGNKLRSVPWTAFEETPNLKILDLKHNRIDAL PEHALKFLPGLTYLDLSSNQLSVISKDVFLNWPLYHSENKHEKPSASNVVLALHDNPWLC DCRLGGFIEFIKSLTPPFILMNSYLTCSSPELKAGRFFHEVDLKTCVKPVVSAPVITITA PLGGNVTLTCSASARPEAVIRWIYALKMLRGFRDILSHVDEDTISSQLVIPSLHSADRGL YTCIANNFLGNSSVIISVDVKSPEGSSSHPSGPSAAIGEENVYIDIRIAKQTVYGITIEW RAVTENPAETWFTIHFGRYDAVKKEQIYIGPGINTYSVTDLLPATKYEICVTLKNQAPRI GQCIVFVTGSDFNEMEQREKLIHIVVIVLAMVLAVPAGMYACTTDAKFNCFERCAELWRN RRHAELSNPTGDRQGTFDSLQAASDEGLYKESNKDKKARRRSAEKIHKTKNDRRPTAELY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the basic structure of the lrit2 protein in Danio rerio?

Danio rerio lrit2 is characterized by its leucine-rich repeat domains, immunoglobulin-like domains, and a transmembrane domain. According to the amino acid sequence, the protein contains multiple structural components including leucine-rich repeats for protein-protein interactions, immunoglobulin-like domains typically involved in cell adhesion or recognition functions, and a transmembrane domain that anchors the protein in the cell membrane. The full amino acid sequence includes 561 amino acids with expression regions at positions 22-561 . The sequence contains characteristic ECFPGCSCG motifs and several domains that are likely crucial for its biological function.

What is the known function of lrit2 in zebrafish eye development?

Current research indicates that lrit2 plays a critical role in proper eye development in zebrafish. Specifically, knockdown studies have demonstrated that reduction of lrit2 expression leads to reduced eye size in zebrafish models . This phenotype suggests that lrit2 is necessary for normal eye growth and development, potentially affecting processes such as cell proliferation, differentiation, or tissue organization within the developing eye. The precise cellular and molecular mechanisms through which lrit2 influences eye size remain to be fully elucidated.

Does lrit2 function relate to other sensory systems besides vision?

While the primary documented function of lrit2 relates to eye development, the potential roles in other sensory systems have not been extensively investigated. Proteins with leucine-rich repeat domains often function in diverse neuronal contexts. By analyzing expression patterns in non-visual sensory structures and conducting targeted knockdown studies with comprehensive phenotypic assessment, researchers could determine whether lrit2 has broader roles in sensory system development or function beyond the visual system.

How does lrit2 interact with other proteins in eye development pathways?

  • Conduct co-immunoprecipitation studies using tagged recombinant lrit2 protein to identify binding partners in zebrafish eye tissue.

  • Employ yeast two-hybrid screening to identify potential interactors.

  • Perform proximity ligation assays to visualize protein interactions in situ.

  • Use phosphoproteomics to identify potential signaling cascades affected by lrit2 knockdown.

The leucine-rich repeat domains likely facilitate specific protein-protein interactions, while the immunoglobulin-like domains may mediate cell-cell interactions or ligand binding. Given its role in eye development, potential interaction partners might include components of pathways regulating retinal lamination or eye growth.

What signaling pathways are disrupted upon lrit2 knockdown in zebrafish?

While specific pathway analysis for lrit2 is limited in the current literature, researchers should consider the following methodological approach:

  • Perform RNA-seq on control versus lrit2 knockdown embryos at key developmental timepoints to identify differentially expressed genes.

  • Conduct pathway enrichment analysis on differentially expressed genes to identify affected signaling networks.

  • Validate key pathway components using quantitative PCR and in situ hybridization.

  • Use small molecule inhibitors or activators of identified pathways to determine if they can rescue or phenocopy the lrit2 knockdown phenotype.

Given the eye size reduction phenotype, pathways regulating cell proliferation, survival, or tissue patterning in the eye are likely affected, potentially including Wnt, Hedgehog, or growth factor signaling networks.

How do the different domains of lrit2 contribute to its function in eye development?

Understanding domain-specific functions requires systematic structure-function analysis:

  • Generate domain-deletion constructs (removing leucine-rich repeats, immunoglobulin domains, or transmembrane domain separately).

  • Assess ability of each construct to rescue lrit2 knockdown phenotypes.

  • Perform subcellular localization studies to determine if domain deletions affect protein targeting.

  • Conduct binding assays to identify which domains mediate specific protein interactions.

This approach would reveal whether the transmembrane domain is primarily required for anchoring, or if it also participates in signaling, and which extracellular domains are critical for developmental functions.

How conserved is lrit2 function across vertebrate species?

An evolutionary analysis of lrit2 could reveal functional conservation and adaptation:

  • Perform phylogenetic analysis of lrit2 sequences across vertebrates, focusing on conservation of key domains.

  • Compare expression patterns of lrit2 orthologs in model organisms like mouse, Xenopus, and chicken.

  • Conduct cross-species rescue experiments to determine functional conservation.

  • Analyze species with naturally occurring lrit2 mutations or adaptations, particularly those with specialized visual systems.

The conservation of lrit2 across species that have undergone independent adaptations of their visual systems would provide insight into the fundamental versus specialized roles of this protein. For instance, examining lrit2 conservation in nocturnal versus diurnal species might reveal adaptations related to different visual requirements.

Is there functional redundancy between lrit2 and related proteins in the zebrafish genome?

To investigate potential functional redundancy:

  • Identify all lrit2-related genes in the zebrafish genome through bioinformatic analysis.

  • Compare expression patterns through in situ hybridization to identify overlapping domains.

  • Perform individual and combined knockdowns to identify synergistic effects.

  • Conduct rescue experiments using related family members to test functional substitution.

This approach would reveal whether lrit2 functions are unique or shared with other family members, providing insight into the evolutionary diversification of this protein family and potential compensatory mechanisms that might mask phenotypes in single-gene studies.

What are the most effective approaches for lrit2 knockdown or knockout in zebrafish?

Several approaches can be used to manipulate lrit2 expression, each with specific advantages:

  • CRISPR/Cas9 gene editing: Design guide RNAs targeting the early exons of lrit2 to create frameshift mutations and premature stop codons. This approach provides complete gene knockout but may trigger genetic compensation .

  • Morpholino antisense oligonucleotides: Design splice-blocking or translation-blocking morpholinos targeting lrit2 mRNA. This approach provides transient knockdown useful for early developmental studies.

  • Inducible expression systems: Generate conditional knockout lines using Cre-loxP or similar systems to control the timing of lrit2 disruption, which can help distinguish between developmental versus physiological roles.

  • Domain-specific modifications: Use CRISPR/Cas9 with ssODN templates to insert stop codons before specific domains (similar to the approach described for lrp2 ), allowing the study of truncated proteins lacking specific domains such as the transmembrane region.

Each approach should include appropriate controls: rescue experiments with wild-type lrit2 mRNA, use of multiple independent guide RNAs or morpholinos, and careful phenotypic validation.

How can CRISPR/Cas9 be used to create precise modifications in the lrit2 gene?

For precise genetic modifications of lrit2, researchers should consider the following protocol:

  • Design guide RNAs targeting the desired modification site in lrit2 using tools like ZiFiT Targeter or CHOPCHOP.

  • For insertions (e.g., adding stop codons or epitope tags), design single-stranded oligodeoxynucleotide (ssODN) templates with 20-30 nucleotide homology arms flanking the insertion sequence .

  • Inject 1-4 cell stage zebrafish embryos with a mixture of guide RNA, Cas9 mRNA with nuclear-localization signals, and the ssODN template .

  • Screen injected fish for germline transmission of the desired modification using PCR and sequencing or restriction enzyme digestion if the modification introduces or removes a restriction site.

  • Establish stable lines by outcrossing founders and confirm the precision of the modification by sequencing.

This approach has been successfully used for precise modifications in zebrafish genes like lrp2, where researchers inserted a 3xSTOP cassette before the transmembrane domain . A similar approach could be applied to create domain-specific modifications in lrit2.

What methods are most appropriate for analyzing eye phenotypes in lrit2-deficient zebrafish?

To comprehensively assess eye phenotypes in lrit2-deficient zebrafish:

  • Morphometric analysis: Measure eye diameter, lens size, and retinal layers at multiple developmental timepoints using brightfield and confocal microscopy.

  • Histological examination: Perform histological sections stained with H&E to assess retinal lamination and cellular organization.

  • Immunohistochemistry: Use antibodies against retinal cell type-specific markers to assess differentiation and organization of various cell types.

  • In vivo imaging: Employ transgenic lines with fluorescent reporters for specific cell types combined with live imaging to track development over time.

  • Functional testing: Assess visual function through optokinetic response (OKR) and visual motor response (VMR) assays.

  • Electron microscopy: Examine ultrastructural features of photoreceptors and other retinal cells for subtle defects not visible by light microscopy.

These complementary approaches would provide comprehensive characterization of the developmental, structural, and functional consequences of lrit2 deficiency.

How can researchers isolate and characterize recombinant lrit2 protein for functional studies?

To obtain functional recombinant lrit2 protein:

  • Clone the lrit2 coding sequence into an appropriate expression vector, either full-length or specific domains depending on research questions.

  • Express the protein in a eukaryotic expression system (e.g., HEK293T cells) to ensure proper folding and post-translational modifications, especially for the leucine-rich repeat and immunoglobulin domains which often require specific disulfide bonding patterns.

  • Include an affinity tag (His, FLAG, etc.) to facilitate purification, ideally with a cleavable linker to remove the tag after purification.

  • Purify using affinity chromatography followed by size exclusion chromatography to ensure homogeneity.

  • Verify structural integrity through circular dichroism or limited proteolysis.

  • For functional studies, the purified protein can be used in:

    • Binding assays to identify interaction partners

    • Cell culture experiments to assess effects on cellular behaviors

    • Crystallization trials for structural studies

    • In vitro assays to test specific biochemical activities

Researchers should be particularly attentive to maintaining the native conformation of the leucine-rich repeat and immunoglobulin domains, as these are likely critical for proper protein-protein interactions.

How might lrit2 function interact with known retinal development and disease genes?

To investigate potential interactions with known eye development genes:

  • Perform epistasis experiments by creating double mutants of lrit2 with known eye development genes.

  • Analyze genetic interactions through enhancement or suppression of phenotypes in double heterozygotes.

  • Compare transcriptomic profiles of lrit2-deficient retinas with published datasets for other eye developmental mutants to identify common pathways.

  • Screen for genetic modifiers of the lrit2 phenotype through forward genetic approaches or targeted candidate gene testing.

Given lrit2's role in eye size regulation, potential interaction partners might include genes involved in:

  • Retinal patterning (pax6, rx, six3)

  • Growth factor signaling (fgf, bmp, shh)

  • Extracellular matrix components important for eye morphogenesis

Could lrit2 have roles in neurodevelopmental processes beyond eye development?

To explore broader neurodevelopmental roles:

  • Perform detailed expression analysis of lrit2 in non-ocular neural tissues using in situ hybridization and reporter lines.

  • Characterize neuroanatomical and behavioral phenotypes in lrit2-deficient fish beyond visual defects, including:

    • Brain morphology and circuit formation

    • Neuronal differentiation in various brain regions

    • Non-visual behavioral assays to assess other sensory or cognitive functions

  • Investigate potential roles in synaptogenesis or axon guidance through in vitro and in vivo assays.

The leucine-rich repeat and immunoglobulin domains found in lrit2 are common in proteins involved in neuronal development and synaptic function, suggesting potential roles beyond eye development that warrant investigation.

How can advanced imaging techniques enhance the study of lrit2 function in the developing zebrafish eye?

Advanced imaging approaches for studying lrit2 function include:

  • Light sheet microscopy: Enables long-term in vivo imaging of eye development in lrit2 mutants with minimal phototoxicity, allowing tracking of cellular behaviors in real-time.

  • Super-resolution microscopy (STED, PALM, STORM): Provides nanoscale resolution of lrit2 localization relative to other proteins at the cell membrane and synaptic structures.

  • Correlative light and electron microscopy (CLEM): Allows identification of lrit2-expressing cells by fluorescence followed by ultrastructural analysis of the same cells.

  • Expansion microscopy: Provides improved resolution of protein localization within densely packed retinal tissues.

  • Lattice light-sheet microscopy: Offers rapid 3D imaging capabilities ideal for capturing dynamic processes during eye development.

These techniques, combined with appropriate labeling strategies such as knock-in fluorescent tags on the endogenous lrit2 locus, would provide unprecedented insights into the dynamics and subcellular localization of lrit2 during eye development.

Comparative Analysis of Leucine-rich Repeat Proteins in Eye Development

ProteinSpeciesEye Development FunctionKnockdown/Knockout PhenotypeRelated PathwaysReference
lrit2Zebrafish (Danio rerio)Eye size regulationReduced eye sizeNot fully characterized
lrp2Zebrafish (Danio rerio)Eye size regulationEnlarged eyes, myopiaRegulates signaling by bound ligands
lrrk2Zebrafish (Danio rerio)Not directly linked to eye developmentReduced catecholaminergic neurons (brain)MAO-dependent catabolic activity
SERPINE3Zebrafish (Danio rerio)Retinal lamination and eye shapeImproper retinal lamination, abnormal eye shapeNot fully characterized

This comparative analysis highlights that multiple leucine-rich repeat containing proteins play crucial but distinct roles in eye development, with some affecting eye size (lrit2, lrp2) and others influencing retinal structure (SERPINE3). The diversity of phenotypes suggests that these proteins likely function in different molecular pathways despite sharing structural similarities.

Experimental Design Considerations for lrit2 Research

Research ObjectiveRecommended MethodologyKey ControlsExpected OutcomesPotential Pitfalls
Generate lrit2 knockoutCRISPR/Cas9 with multiple guide RNAsOff-target analysis, phenotypic rescue with wild-type mRNAStable germline transmission, reduced eye size phenotypeGenetic compensation, lethality
Domain function analysisCRISPR insertion of stop codons before specific domainsWestern blot verification of truncated protein, rescue experimentsDomain-specific contribution to eye phenotypeProtein instability, dominant negative effects
Identify interaction partnersCo-IP followed by mass spectrometryIgG controls, reciprocal pulldowns, validation by direct bindingNovel interactors in eye development pathwaysNon-specific binding, transient interactions missed
Temporal requirement analysisHeat-shock inducible transgenic rescue in knockout backgroundNon-heat shocked controls, multiple induction timepointsIdentification of critical developmental windowsLeaky expression, heat-shock side effects
Cross-species conservationRescue of zebrafish phenotype with mammalian orthologsSpecies-specific codon optimization, matched expression levelsDegree of functional conservation across vertebratesExpression level artifacts, protein folding issues

This table provides a structured approach to designing comprehensive experiments addressing key questions about lrit2 function, with appropriate controls and anticipated outcomes to guide research planning.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.