Recombinant Danio rerio Leukocyte cell-derived chemotaxin 1 (lect1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cnmd; chm1; chmi; lect1; Leukocyte cell-derived chemotaxin 1; Chondromodulin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
170-286
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cnmd
Target Protein Sequence
SATRMRRQTSAGVNRQPARRRNSTASARDERPTGPEYNPENPYHQNQGSEGTMVFDPMLD HRGICCTECHRSYTHCERVCEPLGGYWPWPYNYHGCRPVCRLIMPCRWWAARVLGLV
Uniprot No.

Target Background

Function
Bifunctional growth regulator. It may contribute to the rapid growth of cartilage and vascular invasion before the replacement of cartilage by bone during endochondral bone development. It also plays a role as an antiangiogenic factor in cardiac valves to suppress neovascularization.
Database Links
Protein Families
Chondromodulin-1 family
Subcellular Location
[Chondromodulin-1]: Secreted, extracellular space, extracellular matrix.; [Chondrosurfactant protein]: Endomembrane system; Single-pass membrane protein.

Q&A

What is Recombinant Danio rerio Leukocyte cell-derived chemotaxin 1 (lect1) and what are its key molecular characteristics?

Recombinant Danio rerio lect1 is a protein produced through heterologous expression systems that corresponds to the native zebrafish chemotaxin. The protein is characterized by:

  • Alternative gene names: chm1, chmi

  • Post-translational processing resulting in multiple functional chains including Chondrosurfactant protein, CH-SP, and Chondromodulin-1

  • Expression hosts typically include E. Coli, Yeast, Baculovirus, or Mammalian Cell systems

  • Purification levels generally reach ≥85% purity as determined by SDS-PAGE analysis

For research applications, it is essential to verify whether you require the full-length protein or specific domains, as different recombinant constructs may represent partial or complete sequences depending on experimental goals.

How should researchers distinguish between different expression systems for recombinant lect1 production?

The choice of expression system significantly impacts protein characteristics and downstream applications. Each system offers distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential inclusion bodiesStructural studies, antibody production, protein interaction assays
YeastSome post-translational modifications, higher yields than mammalian systemsGlycosylation patterns differ from vertebratesFunctional studies requiring basic modifications
BaculovirusComplex eukaryotic processing, proper foldingTime-consuming, moderate yieldsEnzymatic assays, receptor-binding studies
Mammalian CellNative-like post-translational modificationsLower yields, higher cost, longer production timeIn vivo applications, complex functional studies

For studying chemotactic functions, mammalian or baculovirus systems are generally preferred as they better preserve the native protein conformation and post-translational modifications critical for biological activity .

What are the optimal methods for assessing chemotactic activity of recombinant zebrafish lect1?

To evaluate chemotactic function of recombinant lect1, researchers should implement a systematic approach:

  • Transwell Migration Assay: Similar to methods used for other chemotaxins like CXCL8, use a chamber with 3.0-μm-pore polycarbonate membrane inserts

  • Cell Preparation: Isolate target leukocytes from zebrafish (typically 1×10^6 cells/mL in appropriate media)

  • Concentration Gradient: Test protein at multiple concentrations (10-500 μg/mL) to establish dose-response relationship

  • Appropriate Controls:

    • Negative control: Phosphate-buffered saline

    • Blocking control: Antibody-blocked recombinant lect1

    • Positive control: Known chemotactic factor for the target cells

  • Quantification: Count migrated cells microscopically and calculate chemotactic index

Analysis should include statistical validation using appropriate tests such as ANOVA followed by multiple comparisons tests to determine significant differences between experimental conditions and controls .

How can researchers effectively validate the purity and identity of recombinant lect1?

A comprehensive validation strategy includes:

  • SDS-PAGE Analysis: Confirm ≥85% purity with appropriate molecular weight markers

  • Western Blot: Verify identity using specific antibodies against lect1 or epitope tags

  • Mass Spectrometry: Confirm protein sequence and identify post-translational modifications

  • Size Exclusion Chromatography: Assess aggregation state and homogeneity

  • Functional Validation: Perform chemotaxis assays with appropriate cell types

  • Endotoxin Testing: Ensure preparations are endotoxin-free (<0.1 EU/μg) for in vivo applications

Importantly, validation must include both structural and functional elements to ensure the recombinant protein represents the native lect1 activity .

How can researchers investigate differential roles of lect1 cleavage products in zebrafish?

Investigating the distinct functions of lect1 cleavage products requires:

  • Domain-specific Constructs: Generate recombinant proteins representing individual chains (Chondrosurfactant protein, CH-SP, Chondromodulin-1)

  • Site-directed Mutagenesis: Create cleavage-resistant variants by mutating processing sites

  • Domain-specific Antibodies: Develop tools that recognize individual domains for localization studies

  • Comparative Functional Assays: Assess chemotactic activity of individual domains versus the full-length protein

  • In vivo Domain Expression: Use transgenic zebrafish expressing individual domains under tissue-specific promoters

This approach enables mapping of function to structure and elucidates whether lect1 activity requires proteolytic processing or if individual domains possess independent biological activities .

What advanced techniques should be employed to study lect1 gene regulation in zebrafish development?

To comprehensively analyze lect1 regulation during development:

  • Temporal Expression Analysis: Quantitative PCR at defined developmental stages (5-20 dpf)

  • Spatial Expression Mapping: In situ hybridization in embryos and tissue sections

  • Promoter Analysis: Identify regulatory elements using reporter constructs

  • Transcription Factor Identification:

    • ChIP-seq to identify protein-DNA interactions

    • EMSA to confirm specific binding

    • Reporter assays with mutated binding sites

  • Epigenetic Regulation: DNA methylation and histone modification analysis

  • Single-cell RNA-seq: Cell-type specific expression patterns during development

Integration of these approaches provides a multi-dimensional understanding of when, where, and how lect1 expression is regulated during zebrafish development .

How should researchers design experiments to compare zebrafish lect1 function with mammalian LECT1?

Cross-species functional comparison requires systematic experimental design:

Experimental AspectMethodological ApproachKey Considerations
Sequence HomologyPhylogenetic analysis, domain conservation mappingFocus on functionally critical regions
Protein StructureComparative modeling, epitope mappingIdentify conserved structural motifs
Receptor BindingCross-species receptor activation assaysTest each protein on both zebrafish and mammalian receptors
Chemotactic ActivityParallel migration assays with standardized conditionsUse both zebrafish and mammalian leukocytes
Gene ExpressionComparative transcriptomics under matched conditionsAnalyze both constitutive and inducible expression
In vivo FunctionRescue experiments in knockout modelsTest if mammalian LECT1 can rescue zebrafish lect1 deficiency

This approach allows researchers to distinguish between conserved functions and species-specific adaptations .

What experimental strategies can elucidate the evolutionary conservation of chemotactic function in vertebrate lect1 orthologs?

To investigate evolutionary conservation of lect1 function:

  • Ortholog Identification: Comprehensive bioinformatic analysis across vertebrate species

  • Recombinant Protein Production: Express lect1 orthologs from multiple species (lamprey, zebrafish, chicken, mammals)

  • Standardized Functional Assays:

    • Chemotaxis assays using leukocytes from different species

    • Cross-species chemotactic activity testing

  • Structural Comparison: Identify conserved motifs (like the GGR motif found in lamprey CXCL8)

  • Receptor Conservation Analysis: Compare putative receptor binding domains

  • Induction Patterns: Compare expression responses to immune challenges across species

This approach allows researchers to trace the evolutionary history of chemotactic function from jawless vertebrates through teleost fish to mammals, providing insights into the origins of vertebrate immune chemotaxis .

How can researchers address inconsistent results in lect1 chemotaxis assays?

When facing variability in chemotaxis experiments, systematically investigate:

  • Protein Quality Assessment:

    • Verify activity with positive control experiments

    • Check for protein degradation by SDS-PAGE

    • Ensure proper storage conditions (-80°C, avoid freeze-thaw cycles)

  • Experimental Variables Control:

    • Standardize cell isolation protocols

    • Maintain consistent temperature (18°C for fish cells)

    • Optimize incubation time (typically 4 hours)

    • Control for cell density (1×10^6 cells/mL)

  • Technical Refinements:

    • Establish optimal concentration range (typically peaks around 200 μg/mL)

    • Use blocking antibodies as specificity controls

    • Include multiple biological replicates

    • Standardize counting methods for migrated cells

  • Statistical Approach:

    • Apply appropriate statistical tests (Brown–Forsythe and Welch ANOVA)

    • Use multiple comparisons tests (Dunnett T3) for non-homogeneous variance

    • Report chemotactic index rather than absolute cell numbers

These systematic approaches minimize variability and enhance reproducibility in chemotaxis assays .

What controls are essential when studying zebrafish lect1 in immune response experiments?

Rigorous immune response studies require comprehensive controls:

  • Negative Controls:

    • Vehicle treatment (PBS)

    • Unrelated recombinant protein of similar size

    • Heat-inactivated lect1

  • Positive Controls:

    • Known chemotactic factors like CXCL8

    • Species-appropriate immune stimulants

  • Specificity Controls:

    • Antibody-blocked lect1

    • Competitive inhibition with excess unlabeled protein

    • Receptor antagonists when available

  • Technical Controls:

    • Endotoxin testing of all preparations

    • Cell viability assessment before and after treatment

    • Time-course experiments to distinguish chemotaxis from chemokinesis

  • Biological Variables Control:

    • Age-matched animals

    • Same genetic background

    • Controlled environmental conditions

    • Sex-balanced experimental design when applicable

Implementing these controls ensures that observed effects are specifically attributable to lect1 function rather than experimental artifacts or contamination .

How should researchers design CRISPR-Cas9 approaches to investigate lect1 function in zebrafish?

Effective CRISPR-Cas9 gene editing for lect1 functional studies requires:

  • Target Site Selection:

    • Design sgRNAs targeting early exons or critical functional domains

    • Avoid regions with high GC content or repetitive sequences

    • Evaluate potential off-target sites using prediction algorithms

  • Experimental Design:

    • Generate multiple independent mutant lines with different target sites

    • Create both knockout and knockin models (for domain-specific studies)

    • Consider conditional knockout approaches for developmental studies

  • Validation Strategy:

    • Sequence verification of mutations

    • RT-PCR and Western blot to confirm loss of expression

    • Structural protein analysis to confirm domain disruption

    • Phenotypic characterization at multiple developmental stages

  • Functional Rescue:

    • Complementation with wild-type lect1 mRNA

    • Domain-specific rescue to map function to structure

    • Cross-species rescue to assess functional conservation

This comprehensive approach enables precise dissection of lect1 function while minimizing misinterpretation due to off-target effects or compensatory mechanisms.

What methodologies can effectively characterize the interactome of zebrafish lect1?

To comprehensively map lect1 protein interactions:

  • Affinity Purification-Mass Spectrometry:

    • Express tagged recombinant lect1

    • Perform pull-down experiments from zebrafish tissue lysates

    • Identify binding partners by mass spectrometry

    • Validate key interactions by co-immunoprecipitation

  • Yeast Two-Hybrid Screening:

    • Use lect1 domains as bait

    • Screen against zebrafish cDNA libraries

    • Confirm interactions in mammalian cells

  • Surface Plasmon Resonance:

    • Measure binding kinetics with purified candidate interactors

    • Determine domain-specific interactions

    • Compare with mammalian ortholog interactions

  • Proximity Labeling:

    • Express BioID or APEX2 fusion proteins in zebrafish

    • Capture transient and stable interactions in vivo

    • Analyze tissue and development-specific interactomes

  • Functional Validation:

    • Co-localization studies

    • Genetic interaction analysis using combined knockdowns

    • Competition assays to confirm specificity

This multi-method approach provides both physical and functional interaction data, creating a comprehensive map of lect1's biological network .

How can zebrafish lect1 research inform therapeutic approaches targeting human LECT1?

Translational applications of zebrafish lect1 research include:

  • Comparative Pathway Analysis:

    • Identify conserved signaling components between zebrafish and human

    • Map effects of lect1 modulation on downstream effectors

    • Determine potential off-target effects of therapeutic interventions

  • Drug Screening Platform:

    • Develop transgenic zebrafish reporters for lect1 activity

    • Screen compound libraries for modulators of lect1 function

    • Assess effects on development, inflammation, and immune response

  • Therapeutic Target Validation:

    • Use genetic models to confirm mechanism of action

    • Test antibody-based approaches for blocking specific domains

    • Evaluate peptide mimetics of functional domains

  • Safety Assessment:

    • Developmental toxicity screening

    • Long-term effects of pathway modulation

    • Effects on normal immune function and tissue homeostasis

This translational approach leverages the experimental advantages of zebrafish while generating data relevant to human therapeutic development .

What are the methodological considerations for studying lect1 in zebrafish models of inflammation and tissue regeneration?

To effectively study lect1 in inflammation and regeneration:

  • Inflammation Models:

    • Caudal fin amputation

    • Chemical-induced inflammation (LPS, copper sulfate)

    • Targeted tissue damage models (laser, genetic cell ablation)

    • Infection models with relevant pathogens

  • Regeneration Assessment:

    • Standardized morphometric analysis

    • Cell proliferation assays (BrdU, EdU incorporation)

    • Lineage tracing of regenerating tissues

    • Time-lapse imaging of reporter lines

  • lect1 Modulation Approaches:

    • Temporal control using heat-shock inducible transgenes

    • Tissue-specific knockdown/overexpression

    • Local delivery of recombinant protein

    • Small molecule modulators of lect1 signaling

  • Integrated Analysis:

    • Transcriptomics at defined regeneration stages

    • Immune cell infiltration assessment

    • Vascular response quantification

    • Extracellular matrix remodeling analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.