Recombinant Danio rerio Lipoma HMGIC fusion partner homolog (lhfp)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Danio rerio Lipoma HMGIC fusion partner homolog (LHFPL3) is a protein expressed in zebrafish (Danio rerio) . LHFPL3 belongs to the lipoma HMGIC fusion partner (LHFP) gene family, a subset of the tetraspan transmembrane protein superfamily . LHFP family members are associated with various biological processes, including tumorigenesis and hearing function .

Gene and Protein Information

The lhfpl3 gene in Danio rerio encodes the LHFPL3 protein . The human homolog of LHFPL3 is known as LHFPL1 or LHFPL6 .

Key characteristics of the Danio rerio LHFPL3 protein:

  • Species: Danio rerio (Zebrafish)

  • UniProt ID: Q6DHB5

  • Function: Predicted to be involved in the sensory perception of sound, located in the plasma membrane, and active in the membrane .

  • Role: The LHFP gene family is related to the tetraspanin superfamily of proteins .

LHFP Family and Function

The lipoma HMGIC fusion partner (LHFP) gene family is characterized by genes encoding tetraspan transmembrane proteins . These proteins have been implicated in diverse biological functions:

  • Tumorigenesis: The founding member of this family, LHFP, was identified as a fusion partner of the HMGIC gene in lipomas, which are common benign tumors of mesenchymal origin . Chromosomal translocations involving the HMGIC gene at 12q15 are a frequent occurrence in lipomas. The LHFP gene, located on chromosome 13, can act as a translocation partner of HMGIC in lipomas with t(12;13) .

  • Hearing Loss: Mutations in LHFP-like genes (e.g., LHFPL1, LHFPL5) have been linked to deafness in humans and mice . LHFPL5, in particular, plays a vital role in the auditory system, influencing mechanotransduction, olivocochlear synapse function, morphology, and different signaling pathways .

Recombinant LHFPL3

Recombinant LHFPL3 protein is produced using genetic engineering techniques . This involves introducing the lhfpl3 gene into a host cell (e.g., E. coli) and inducing the cell to produce the protein. The recombinant protein is then purified for use in research applications.

  • Product Type: Recombinant Protein

  • Tag Information: The specific tag type is determined during the production process .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability .

Research Applications

Recombinant LHFPL3 protein and other LHFP family members are valuable tools for investigating various biological processes:

  • Studying the molecular mechanisms underlying tumorigenesis, particularly in lipomas .

  • Elucidating the role of LHFPL3 in hearing and deafness .

  • Investigating the function of tetraspan transmembrane proteins in cellular signaling and communication .

  • Developing potential therapeutic interventions for lipomas and hearing disorders .

DPP-4 Inhibitors

Fused β-homophenylalanine derivatives have been designed, synthesized, and evaluated as DPP-4 inhibitors . Most of these derivatives displayed excellent DPP-4 inhibitory activities and selectivity .

CompoundIC50 (nM)
9aa10.8
18a4.9
18mN/A

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
lhfpl6; zgc:101683; LHFPL tetraspan subfamily member 6 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-200
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
lhfpl6
Target Protein Sequence
TSCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLE WRICTVVTGIGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGSGCALYPL GWDSEEVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCTWMACFAGKKQKHYPY
Uniprot No.

Target Background

Database Links
Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Danio rerio Lipoma HMGIC fusion partner homolog (lhfp)?

Recombinant Danio rerio Lipoma HMGIC fusion partner homolog (lhfp) is a tetra-transmembrane protein expressed in zebrafish. The recombinant form is produced for research purposes and has the UniProt accession number Q5PRC1. The protein is typically stored in a Tris-based buffer with 50% glycerol for stability and has a partial amino acid sequence that includes specific transmembrane domains: "TSCVGFFMPYWLLGSQMGKPVSFGTFRRCSYPIRDEARGGTVMLEQCGRYASFQGIPSLEWRICTVVTGIGCGLLLLVALTAIMGCCVTDLISRTIGRVAGGIQFVGGLLIGSGCALYPLGWDSEEVRQTCSNSSDQFDLGSCEIGWAYYCTGAGAAAAMVLCTWMACFAGKKQKHYPY" .

Why are zebrafish (Danio rerio) used as models for studying lhfp function?

Zebrafish provide an excellent model for studying lhfp function because approximately 70% of human protein-coding genes are linked to genes found in zebrafish, and 84% of genes associated with human disease have homologous genes in zebrafish . Specifically for lhfp and related studies, zebrafish offer several advantages: 1) transparent embryos allowing for real-time visualization of developmental processes, 2) rapid development enabling efficient experimental timelines, 3) genetic tractability for creating knockout models, and 4) similarities in signaling pathways and organ systems to humans that confer good descriptive validity in pathophysiological analyses . Unlike some mammalian models with mutations in related genes that die shortly after birth, zebrafish with genetic modifications often survive to adulthood, allowing for more comprehensive studies of gene function throughout the life cycle .

What are the primary storage and handling considerations for Recombinant Danio rerio lhfp protein?

The recombinant lhfp protein requires specific storage conditions to maintain stability and activity. It should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular storage, or at -80°C for extended preservation . To preserve protein integrity, repeated freezing and thawing cycles should be avoided. Working aliquots can be maintained at 4°C for up to one week . When designing experiments, researchers should consider the protein's stability in their specific experimental conditions and prepare appropriate positive and negative controls to validate protein function.

How do knockout/mutation models of lhfp and related genes in zebrafish inform our understanding of their function?

Studies of lhfp-related gene knockouts in zebrafish provide significant insights into gene function. While direct lhfp knockout data in zebrafish is limited in the provided search results, research on related genes offers methodological frameworks. For instance, lhx4-knockout zebrafish models demonstrate that, unlike their mouse counterparts that die shortly after birth, zebrafish with this mutation survive to adulthood but exhibit phenotypes resembling Combined Pituitary Hormone Deficiency (CPHD) in humans, including reduced body size and sex-specific reproductive impacts . Similar approaches can be applied to lhfp studies, where CRISPR-Cas9 or other gene editing techniques can be employed to create zebrafish models with lhfp mutations. These models would then be analyzed for phenotypic changes across developmental stages and in specific tissues where lhfp is expressed .

What methodological challenges exist in studying the temporal and spatial expression patterns of lhfp in zebrafish?

Studying lhfp expression patterns presents several methodological challenges. First, researchers must determine the appropriate developmental timepoints for analysis, as expression patterns may vary throughout embryonic development and adulthood. Techniques such as in situ hybridization for mRNA detection or immunohistochemistry for protein localization require optimization of probe design and antibody specificity for lhfp . Additionally, the tetra-transmembrane nature of the protein can complicate antibody accessibility in fixed tissues. To overcome these challenges, researchers often employ transgenic approaches using fluorescent reporter genes under the control of the lhfp promoter, allowing for real-time visualization of expression patterns . RNA-seq analysis across developmental stages and different tissues can provide comprehensive expression profiles, though validation through qPCR and protein detection methods remains essential.

How might sex-dependent differences impact lhfp function studies in zebrafish models?

Sex-dependent differences are critical considerations in lhfp studies, as several zebrafish research models demonstrate significant sexual dimorphism in gene expression and phenotypic manifestations. For example, long-term exposure studies to environmental compounds in zebrafish show sex-dependent alterations in hormone levels and gene expression patterns . In female zebrafish, certain exposures result in increases in plasma cortisol, follicle stimulating hormone (FSH), luteinizing hormone (LH), and other hormones, while in males, decreases in these same hormones are observed . Similarly, studies of reproductive tract development associated with lhfp-related genes show sex-specific phenotypes, with females exhibiting more severe reproductive abnormalities than males . Therefore, experimental designs for lhfp function studies should incorporate sex as a biological variable, analyzing male and female zebrafish separately and potentially investigating sex-specific regulatory mechanisms that might influence lhfp expression or function.

What are the optimal methods for phenotypic characterization in lhfp-modified zebrafish models?

The optimal phenotypic characterization of lhfp-modified zebrafish should employ a multi-dimensional approach. Beginning with developmental assessments, researchers should document morphological changes throughout embryogenesis, larval stages, and into adulthood using high-resolution imaging techniques. For reproductive function assessment, which may be particularly relevant given lhfp's potential role in reproductive tract development (as suggested by studies of related genes), analyses should include gonadal histology, fertility testing, and hormone profiling . Bone density and structure should be evaluated using micro-CT scanning, as lhfp has been identified as a regulator of osteoblast activity and bone mass in other models . Additionally, molecular phenotyping via RNA-seq of relevant tissues can reveal downstream effects of lhfp modification on gene expression networks. This comprehensive approach should be applied to both male and female fish, given the potential for sex-specific effects, and include age-matched wild-type controls for comparison .

What considerations should be made when designing expression vectors for recombinant lhfp studies?

When designing expression vectors for recombinant lhfp studies, researchers should consider several key factors. First, the choice of promoter is critical—constitutive promoters like CMV may be suitable for high-level expression, while tissue-specific or inducible promoters can provide more controlled expression for functional studies. The inclusion of appropriate tags (e.g., His, FLAG, or GFP) should be carefully considered, as the tetra-transmembrane nature of lhfp means tags could interfere with proper protein folding or localization . Researchers should position tags at either the N- or C-terminus based on predicted membrane topology to minimize functional disruption. Codon optimization for expression in the chosen system (bacterial, insect, or mammalian cells) is also important for efficient protein production. Additionally, the vector should include appropriate selectable markers and origin of replication compatible with the expression system. Finally, researchers should consider incorporating site-specific recombination sites to facilitate subcloning into various expression vectors for different experimental purposes.

How should researchers interpret contradictory results between zebrafish lhfp studies and mammalian models?

When faced with contradictory results between zebrafish lhfp studies and mammalian models, researchers should implement a systematic analysis framework. First, examine the specific genetic modifications—complete knockouts may produce different phenotypes than point mutations or partial deletions . Second, consider evolutionary divergence; while zebrafish share high genomic homology with humans (70% of protein-coding genes), functional divergence may exist for specific genes like lhfp . Third, evaluate compensatory mechanisms, as zebrafish possess genome duplication events that might provide redundant functions through paralogous genes . Fourth, assess developmental timing differences, as zebrafish develop externally and rapidly compared to mammals, potentially masking certain phenotypes or revealing others . Finally, methodological differences in phenotypic assessment can lead to apparent contradictions. To resolve these contradictions, researchers should: 1) perform detailed comparative sequence and expression analyses between species, 2) generate equivalent genetic modifications across models, 3) employ consistent phenotyping protocols, and 4) consider using complementary approaches such as cell-based assays to isolate specific molecular functions of lhfp independent of organismal context.

What statistical approaches are most appropriate for analyzing gene expression data in lhfp-related zebrafish studies?

For analyzing gene expression data in lhfp-related zebrafish studies, researchers should employ a combination of statistical approaches tailored to the experimental design. For RNA-seq data comparing wild-type and lhfp-modified zebrafish, differential expression analysis using tools like DESeq2 or edgeR is appropriate, applying false discovery rate (FDR) correction for multiple testing . When analyzing sex-specific differences, a two-factor design incorporating both genotype and sex as variables should be used, with interaction terms to identify genes differentially affected by lhfp modification in a sex-dependent manner . For time-course experiments examining lhfp expression throughout development, mixed-effects models can account for repeated measurements and developmental stage variations. Network analysis approaches, including weighted gene co-expression network analysis (WGCNA), can identify gene modules associated with lhfp function . For all analyses, researchers should report effect sizes alongside p-values and validate key findings using quantitative PCR. Power analyses should be conducted a priori to ensure sufficient biological replicates (typically at least n=3-5 per condition) for reliable statistical inference.

How can zebrafish lhfp studies inform human disease research, particularly for conditions affecting bone development and reproductive systems?

Zebrafish lhfp studies can provide valuable insights into human disease mechanisms, particularly for conditions affecting bone development and reproductive systems. For bone-related research, lhfp has been identified as a regulator of osteoblast activity and bone mass in mouse models, suggesting similar functions may exist in zebrafish and humans . Researchers can utilize zebrafish lhfp models to study bone formation processes in real-time during development, screen for compounds that modulate lhfp activity, and identify downstream signaling pathways relevant to human bone disorders . For reproductive system research, studies of lhfp-related genes demonstrate roles in distal reproductive tract development, with mutations leading to infertility and structural abnormalities . Zebrafish lhfp models can help elucidate the molecular mechanisms underlying these phenotypes through detailed analysis of reproductive tract formation during development and hormonal regulation . A particularly valuable approach is creating zebrafish models with specific lhfp mutations identified in human patients, allowing for direct testing of pathogenicity and potential therapeutic interventions in a whole-organism context with high genetic conservation to humans .

What are the most effective techniques for comparing protein function between recombinant Danio rerio lhfp and its human homolog?

The most effective techniques for comparing protein function between recombinant Danio rerio lhfp and its human homolog involve a multi-faceted approach combining structural, biochemical, and cellular analyses. Beginning with bioinformatic comparisons, researchers should analyze sequence conservation, predicted protein structure, and evolutionary relationships . For biochemical characterization, both proteins should be expressed with identical tags in the same expression system to ensure comparable purification and analysis conditions. Binding partner identification using techniques such as co-immunoprecipitation followed by mass spectrometry can reveal conservation or divergence in protein interaction networks . Cellular localization studies using fluorescently tagged versions of both proteins in various cell types can determine whether subcellular distribution is conserved. Cross-species rescue experiments, where human lhfp is expressed in zebrafish lhfp knockout models, provide functional validation of conserved activity . Domain swap experiments, creating chimeric proteins with domains from each species, can identify which regions are responsible for species-specific functions. Additionally, CRISPR-Cas9 genome editing can be used to "humanize" specific domains of zebrafish lhfp to directly test functional equivalence in vivo.

What emerging technologies could enhance the study of lhfp function in zebrafish models?

Emerging technologies that could significantly enhance lhfp function studies in zebrafish include advanced genetic and imaging techniques. CRISPR-based technologies beyond simple knockouts, such as CRISPR activation (CRISPRa) and CRISPR interference (CRISPRi), would allow temporal and tissue-specific modulation of lhfp expression without permanent genetic modification . Base editing and prime editing technologies could enable precise introduction of specific mutations to model human variants of interest. For imaging, light sheet microscopy combined with tissue clearing techniques provides unprecedented visualization of protein expression and cellular processes in intact zebrafish embryos and adults . Single-cell RNA sequencing would reveal cell type-specific responses to lhfp modification, particularly valuable in heterogeneous tissues like developing gonads or bone . Spatial transcriptomics techniques could map gene expression changes in their tissue context, providing insights into how lhfp affects local cellular environments. Finally, integrating these approaches with systems genetics methods that incorporate quantitative trait loci (QTL) analysis could identify genetic modifiers of lhfp function, explaining variable phenotypes observed in different genetic backgrounds .

How might high-throughput drug screening approaches utilizing lhfp zebrafish models contribute to therapeutic development?

High-throughput drug screening utilizing lhfp zebrafish models could significantly accelerate therapeutic development through several innovative approaches. Researchers could generate transgenic zebrafish lines expressing fluorescent reporters under the control of lhfp-responsive promoters, allowing for rapid visual assessment of compounds that modulate lhfp activity or downstream pathways . For lhfp-associated bone disorders, automated imaging platforms could quantify changes in bone formation or density in response to candidate compounds . Similarly, for reproductive phenotypes, screens could identify compounds that rescue fertility or reproductive tract development in lhfp-modified models . The zebrafish model is particularly advantageous for such screens as it combines the biological relevance of a vertebrate system with the practical benefits of small size, rapid development, and amenability to automated handling . Importantly, this approach enables simultaneous assessment of efficacy and toxicity, as researchers can monitor both target phenotype improvement and potential adverse effects on development or physiology. To maximize translational potential, validated hits from zebrafish screens should be further characterized in mammalian models and human cell-based assays, creating a comprehensive drug discovery pipeline that leverages the unique advantages of each system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.