Recombinant Danio rerio Lipoma HMGIC fusion partner-like 2 protein (lhfpl2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Lipoma HMGIC Fusion Partner-Like 2 Protein (lhfpl2)

The Recombinant Danio rerio Lipoma HMGIC fusion partner-like 2 protein (lhfpl2) is a synthetic, bioengineered version of the zebrafish homolog of the LHFPL2 protein. This protein belongs to the lipoma HMGIC fusion partner (LHFP) gene family, characterized by tetra-transmembrane domain structures and roles in cellular signaling and development . In zebrafish, lhfpl2 is expressed in reproductive and epithelial tissues, mirroring its conserved function across species . Recombinant production enables precise study of its biochemical properties and applications in research.

Protein Structure

  • Domain Architecture: Predicted to be a tetra-transmembrane protein with 222–247 amino acids, featuring four transmembrane domains, extracellular loops, and intracellular termini .

  • Molecular Weight: ~24.3 kDa (full-length) .

  • Alternate Splice Variants: Multiple transcripts exist, including full-length (222 aa) and truncated forms (e.g., 139 aa, 34 aa) .

Functional Roles

Recombinant Production Systems

lhfpl2 is produced via heterologous expression in diverse hosts:

Host SystemApplicationsPurity (SDS-PAGE)
E. coliHigh-yield protein production≥85%
YeastProper post-translational modifications≥85%
BaculovirusComplex protein folding≥85%
Mammalian cellsNative-like protein structure≥85%

Partial recombinant proteins (e.g., truncated domains) are also available for specific experimental needs .

Quality Control

  • Purity: Consistently ≥85% as validated by SDS-PAGE and Coomassie blue staining .

  • Tagging: Some variants include fusion tags (e.g., Myc-DYKDDDDK) for detection and purification .

Experimental Uses

  1. Western Blotting: Detection of lhfpl2 expression in zebrafish tissues or recombinant protein validation .

  2. ELISA: Quantitative analysis of lhfpl2 levels in biological samples .

  3. Antibody Production: Serves as an antigen for generating polyclonal antibodies (e.g., rabbit anti-Danio rerio lhfpl2) .

Key Findings from Related Studies

  • Reproductive Development: Zebrafish lhfpl2 may regulate reproductive tract morphogenesis, though direct evidence remains limited .

  • Cancer Immunology: Human LHFPL2’s association with M2 macrophages highlights its potential as a biomarker for tumor microenvironment modulation, a pathway possibly conserved in zebrafish .

Comparative Analysis of Recombinant lhfpl2 Products

FeatureFull-Length lhfpl2Partial lhfpl2
HostHEK293, BaculovirusE. coli, Yeast
FunctionalityNative-like activityDomain-specific studies
ApplicationsStructural studiesEpitope mapping
Price Range$500–$600 (20 µg) Variable

Challenges and Future Directions

  • Sequence Gaps: Complete amino acid sequences for Danio rerio lhfpl2 remain unpublished, limiting structural modeling .

  • Functional Studies: Direct evidence of lhfpl2’s role in zebrafish development or disease is sparse, necessitating further knockout or CRISPR-based studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lhfpl2a; zgc:77456; LHFPL tetraspan subfamily member 2a protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
lhfpl2a
Target Protein Sequence
MCHVIVTCRSMLWTLLSIVAAFSELIAFLSTDWLVGFPRAPDAGFSPLGATAAGEAYRPT LGIYGRCIRVPHYRRGVLCGPYAVHFGEIASGFWQATAIFLAAGILLLCAVAFISIFTMC FQSIMKKSIFNVCGLLQAIAGLFLIVGLVLYPAGWGSQKVQLYCGPDSSPYRLGLCSAGW AFYTALAGTVLCFLCAVFSAQAEIATSSDKVQEEIQEGKSLICLL
Uniprot No.

Target Background

Function
Plays a role in fertility. Involved in distal reproductive tract development.
Database Links

KEGG: dre:402962

UniGene: Dr.14573

Protein Families
LHFP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of LHFPL2 in zebrafish compared to other teleosts?

LHFPL2 belongs to the lipoma HMGIC fusion partner family of transmembrane proteins. While detailed genomic information specific to LHFPL2 is limited in the provided data, the approach to understanding its genomic organization would be similar to other conserved protein families in zebrafish. For example, in the PKD gene family, researchers have successfully mapped the complete family by describing genomic locations and sequences, identifying potential ohnologs preserved from whole genome duplication events that occurred at the base of teleosts . This approach can be applied to study LHFPL2's genomic organization through comparative genomics between zebrafish and other teleost species.

What is the expression pattern of LHFPL2 during zebrafish development?

For LHFPL2 expression analysis, methodological approaches similar to those used for PKD genes would be appropriate. This includes whole-mount in situ hybridization to visualize spatial expression patterns throughout embryonic development. Based on studies of other transmembrane proteins in zebrafish, expression analysis should include:

  • Temporal profiling (expression at different developmental stages)

  • Spatial mapping (tissue-specific expression)

  • Co-expression analysis with potential interacting partners

Researchers should examine expression in developing structures including the nervous system, sensory organs, and the developing kidney (pronephros), as these are common sites of expression for transmembrane proteins in zebrafish .

What are the best methods for generating LHFPL2 loss-of-function models in zebrafish?

For LHFPL2 loss-of-function studies, researchers can employ several approaches:

  • CRISPR/Cas9 genome editing: Design guide RNAs targeting conserved exons, particularly those encoding functional domains. This approach was successfully used to generate knockout models for other transmembrane proteins like PKD .

  • Morpholino knockdown: While less permanent than CRISPR editing, morpholinos can provide rapid preliminary data on developmental functions. Always validate with rescue experiments using recombinant protein or mRNA.

  • Generation of nonsense mutations: Similar to the approach used for plod2 mutants, where a nonsense mutation (p.Y679X) was introduced in a conserved catalytic domain .

  • Transgenic rescue lines: After establishing knockout lines, create transgenic lines expressing fluorescently-tagged LHFPL2 under tissue-specific promoters to validate phenotypes and study protein localization.

Validation of knockout efficiency should include Western blotting and immunostaining to confirm protein reduction, as demonstrated in plod2 mutants where a 60-65% reduction was confirmed in embryos and adult tissues .

What are the optimal protocols for producing recombinant Danio rerio LHFPL2 protein?

For recombinant LHFPL2 production:

  • Expression system selection: For transmembrane proteins like LHFPL2, mammalian expression systems (HEK293 or CHO cells) often provide better folding and post-translational modifications than bacterial systems.

  • Construct design considerations:

    • Include affinity tags (His6 or FLAG) for purification

    • Consider removing predicted signal peptides for improved expression

    • Test both full-length and truncated versions (excluding transmembrane domains) to improve solubility

  • Purification strategy:

    • Detergent screening to identify optimal solubilization conditions

    • Two-step purification (affinity chromatography followed by size exclusion)

    • Quality control through Western blotting and mass spectrometry

  • Functional validation: Develop activity assays specific to LHFPL2's predicted functions to confirm that the recombinant protein maintains native activity.

How can single-cell RNA sequencing approaches be applied to study LHFPL2 function in zebrafish?

Single-cell RNA sequencing (scRNA-seq) methodology for LHFPL2 research should include:

  • Tissue preparation: Optimized dissociation protocols to maintain cell viability while ensuring complete dissociation, particularly important for tissues where LHFPL2 is expressed.

  • Sequencing depth considerations: Aim for >100,000 reads per cell to capture low-abundance transcripts like LHFPL2.

  • Analysis pipeline:

    • Identify cell populations expressing LHFPL2

    • Perform co-expression analysis to identify potential signaling pathways

    • Compare wild-type and LHFPL2 mutant transcriptomes to identify dysregulated genes

  • Integrative analysis: Similar to the approach used in LHFPL2 studies in renal carcinoma, integrate scRNA-seq data with bulk transcriptomic data to identify cell-type specific effects .

  • Validation: Confirm key findings using in situ hybridization and immunostaining.

How does LHFPL2 influence zebrafish immune system development and function?

Based on findings that LHFPL2 influences immune infiltration in cancer contexts, researchers investigating its role in immune development should:

  • Characterize immune cell populations in LHFPL2 mutants:

    • Use flow cytometry with established zebrafish immune cell markers

    • Employ transgenic reporter lines (mpx:GFP for neutrophils, mpeg1:GFP for macrophages)

  • Assess immune response to challenges:

    • Bacterial infection models (e.g., Mycobacterium marinum)

    • Wound healing assays to evaluate immune cell recruitment

  • Investigate macrophage polarization:

    • Examine M1/M2 marker expression through qPCR and immunostaining

    • Assess functional polarization through phagocytosis and cytokine production assays

Since LHFPL2 expression has shown positive correlation with M2 macrophage polarization in cancer studies , researchers should particularly focus on macrophage behavior and polarization in zebrafish models.

What is the relationship between LHFPL2 and other transmembrane proteins in zebrafish development?

To investigate protein interactions:

  • Co-immunoprecipitation studies: Using antibodies against LHFPL2 to pull down protein complexes, followed by mass spectrometry to identify interacting partners.

  • Proximity labeling approaches: BioID or APEX2 fusions with LHFPL2 to identify proteins in close proximity in vivo.

  • Co-expression analysis: Similar to studies of PKD family members where co-expression of one pkd1-like gene and one pkd2-like gene was consistent with these genes encoding heteromeric protein complexes .

  • Genetic interaction studies: Generate double mutants (LHFPL2 with potential interacting partners) to identify synergistic or epistatic relationships.

  • Domain-specific function analysis: Create chimeric proteins by swapping domains between LHFPL2 and related proteins to map functional regions.

How can zebrafish LHFPL2 models be used to understand human disease mechanisms?

LHFPL2 has been implicated in cancer progression, particularly in renal cell carcinoma, making zebrafish models valuable for understanding disease mechanisms:

  • Cancer models:

    • Develop transgenic lines overexpressing LHFPL2 in specific tissues

    • Assess tumor development, progression, and metastasis

    • Evaluate immune cell infiltration and polarization, given LHFPL2's association with M2 macrophage polarization

  • Molecular pathway analysis:

    • Investigate whether zebrafish LHFPL2 influences similar pathways as in human cancer:

      • Hypoxia responses

      • Immune evasion mechanisms

      • Angiogenesis

  • Drug screening approach:

    • Test predicted drug candidates like conivaptan and nilotinib that have been proposed to target LHFPL2

    • Develop medium-throughput screening assays using LHFPL2 mutant phenotypes

  • Comparative expression analysis: Examine expression patterns in zebrafish disease models compared to human patient samples.

What are the technical challenges in studying LHFPL2 protein-protein interactions in zebrafish models?

Researchers face several challenges when investigating LHFPL2 interactions:

  • Antibody availability and specificity:

    • Limited commercial antibodies for zebrafish LHFPL2

    • Solution: Generate custom antibodies against conserved epitopes or use epitope tagging approaches

  • Membrane protein solubilization:

    • Transmembrane proteins require careful detergent optimization

    • Solution: Screen multiple detergent conditions and consider nanodiscs or amphipols for maintaining native structure

  • Low endogenous expression levels:

    • May be difficult to detect in certain tissues

    • Solution: Employ targeted enrichment techniques or develop sensitive reporters

  • Distinguishing direct vs. indirect interactions:

    • Solution: Use crosslinking approaches combined with mass spectrometry or yeast two-hybrid screens with membrane systems

  • Functional validation of interactions:

    • Solution: Develop quantitative assays for specific cellular functions affected by LHFPL2

How should researchers interpret zebrafish LHFPL2 expression data in the context of evolutionary conservation?

When analyzing LHFPL2 expression data:

  • Multi-species comparison framework:

    • Compare LHFPL2 expression patterns across model organisms (zebrafish, mouse, human) and other teleosts

    • Identify conserved expression domains versus species-specific patterns

    • Use phylogenetic approaches similar to those applied to PKD gene family analysis

  • Developmental context considerations:

    • Map expression to homologous structures across species, accounting for developmental differences

    • Consider heterochrony (timing differences) in expression patterns between species

  • Functional domain conservation:

    • Analyze conservation at protein domain level rather than whole-protein level

    • Focus on functional motifs and interaction surfaces

SpeciesConserved Expression DomainsSpecies-Specific ExpressionKey Functional Domains
ZebrafishNeural tissues, developing organsPotential taste receptor regionsTransmembrane domains, protein interaction motifs
MouseNeural tissues, developing organsSpecies-specific structuresHighly conserved C-terminal region
HumanNeural tissues, developing organsPrimate-specific structuresConserved ligand-binding regions

What statistical approaches are most appropriate for analyzing LHFPL2 expression changes in zebrafish disease models?

For robust statistical analysis:

  • Experimental design considerations:

    • Minimum biological replicates (n≥5 per condition)

    • Include appropriate controls (wild-type siblings, sham treatments)

    • Account for batch effects and developmental timing

  • Quantitative expression analysis:

    • For qPCR data: Use ΔΔCt method with multiple reference genes

    • For RNA-seq: Apply DESeq2 or edgeR workflows with appropriate normalization

    • For protein quantification: Consider multiple normalization approaches (total protein, housekeeping proteins)

  • Multi-omics data integration:

    • Correlate transcriptome and proteome data

    • Apply dimension reduction techniques (PCA, t-SNE) for pattern identification

    • Use pathway enrichment analysis to contextualize expression changes

  • Spatial statistics for imaging data:

    • Develop quantification methods for expression domain size, intensity, and colocalization

    • Apply computational image analysis for unbiased quantification

  • Accounting for genetic background effects:

    • Control for strain-specific variations

    • Consider using multiple genetic backgrounds to validate findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.