Recombinant Danio rerio Lysocardiolipin acyltransferase 1 (lclat1)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions

lclat1 catalyzes acyl group transfer in phospholipid remodeling, with specificity for anionic substrates:

Key Activities:

  • Lysocardiolipin Acyltransferase (ALCAT): Reacylates lyso-cardiolipin (CL) to CL using linoleoyl-CoA or oleoyl-CoA .

  • Lysophosphatidylinositol Acyltransferase (LPIAT): Synthesizes phosphatidylinositol (PI) .

  • Lysophosphatidylglycerol Acyltransferase (LPGAT): Produces phosphatidylglycerol (PG) .

Substrate Preferences:

SubstrateAcyl Donor PreferenceActivity Level
MonolysocardiolipinLinoleoyl-CoA > Oleoyl-CoA High (V<sub>max</sub>)
LysophosphatidylinositolOleoyl-CoA Moderate
LysophosphatidylglycerolOleoyl-CoA Moderate

Pathways and Physiological Roles

lclat1 is integral to lipid metabolic pathways in zebrafish:

PathwayRoleRelated Proteins
Glycerophospholipid MetabolismRemodels cardiolipin and PI for mitochondrial function AGPAT3, LPCAT1, PLD4
Hematopoietic DevelopmentRequired for endothelial and blood cell lineage establishment TGF-β signaling components

Studies in zebrafish embryos show lclat1 knockdown disrupts heart development, underscoring its role in energy-demanding tissues .

Research Applications

  • Lipidomics: Used to reconstitute CL species in vitro for mass spectrometry analysis .

  • Disease Modeling: Investigated in metabolic disorders linked to mitochondrial dysfunction .

  • Structural Studies: Mutagenesis of residues (e.g., D168, L169) reveals substrate-binding mechanisms .

Functional Insights from Mutational Analysis

Critical residues for enzymatic activity were identified through mutagenesis:

ResidueFunctionImpact of Mutation
D168LysoPL substrate binding >80% loss of LPIAT/LPGAT activity
L169Stabilizes acyl-CoA interaction Reduced V<sub>max</sub> for CL synthesis

Comparative Analysis Across Species

While Danio rerio lclat1 shares 65% sequence identity with human LCLAT1, its ER localization and preference for linoleoyl-CoA are conserved . Zebrafish models are particularly valuable for studying developmental defects caused by lclat1 dysregulation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, kindly indicate them during order placement. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lclat1; agpat8; lycat; zgc:77380; Lysocardiolipin acyltransferase 1; 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-AGP acyltransferase 8; 1-AGPAT 8; Acyl-CoA:lysocardiolipin acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
lclat1
Target Protein Sequence
MVSPRGVCFLLFLLLGSVFGSVFMLGPLLPLMLLSPSRYRWITDRIVATWLTLPVALLEL VLGVKVVVTGDGFIPGERSVIIMNHRTRLDWMFLWCCLLRYSYLRQEKICLKAALKSVPG FGWAMQVASFIFIQRRWEDDRTHMSNMLQYFCRIREPVQLLLFPEGTDLTENTRARSDEF AEKNGLQKYEYVLHPRTTGFTFIVDTLRGGDNLDAVHDITVAYPQNIPQTERHLLAGVFP REIHFHVQRFTVASVPAGAAGLQAWCQERWREKERRLQRFYETVPRRFDAPAVGVCVREP CCQSGQCVCVPRCKSEGRVRIILVASLLYWSVFITAACASLCLCPPAQFYFLFMVVFFLC QQRFTGGLELMELACHRYWSRRSADKQE
Uniprot No.

Target Background

Function
Lysocardiolipin acyltransferase 1 (LCAT1) exhibits acyl-CoA:lysocardiolipin acyltransferase (ALCAT) activity. This enzyme catalyzes the reacylation of lyso-cardiolipin to cardiolipin (CL), a crucial step in CL remodeling. LCAT1 recognizes both monolysocardiolipin and dilysocardiolipin as substrates, with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. It also demonstrates 1-acyl-sn-glycerol-3-phosphate acyltransferase activity (AGPAT) activity, converting 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. LCAT1 possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LCAT1 is essential for the establishment of hematopoietic and endothelial lineages.
Gene References Into Functions
  1. Research indicates that LCAT1 is the earliest known factor involved in the development of both endothelial and hematopoietic lineages. PMID: 18388326
Database Links

KEGG: dre:406554

UniGene: Dr.80904

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Lysocardiolipin Acyltransferase 1 (lclat1) in Danio rerio?

Lysocardiolipin acyltransferase 1 (lclat1) in Danio rerio is a transmembrane acyltransferase enzyme with a C-terminal endoplasmic reticulum localization signal. It plays a critical role in phospholipid metabolism and remodeling, particularly in the reacylation of lyso-cardiolipin to cardiolipin, a key step in cardiolipin remodeling. The protein exhibits both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities, and is fundamentally involved in glycerophospholipid biosynthesis pathways . In zebrafish, lclat1 has been identified as an essential regulator for the establishment of both hematopoietic and endothelial lineages, making it one of the earliest known molecular players in hemangioblast development .

The gene has been mapped to the telomere of chromosome 13 in zebrafish, near microsatellite markers Z17223, Z22194, and Z10362, and was isolated from the deletion interval of the cloche mutant, which exhibits severely reduced hematopoietic and endothelial cell lineages . This genetic positioning provides important context for understanding its developmental functions.

Alternative Nomenclature and Gene Identification

Multiple designations exist for this gene across databases and research literature, which is important to consider when conducting literature searches or database queries. The recognized alternative gene names include:

SpeciesPrimary NameAlternative Gene NamesDatabase Identifiers
Danio reriolclat1lycat, lycat1, zgc:77380, wu:fj17g04
HumanLCLAT1AGPAT8, ALCAT1, LYCAT, 1AGPAT8, UNQ1849, HSRG1849HGNC (26756), NCBI Gene (253558), Ensembl (ENSG00000172954)
MouseLclat1Alcat1, Gm91, Lycat, Agpat8, AI181996

Understanding these alternative designations is essential when performing cross-species comparisons or when searching for functional orthologs in comparative studies .

What functional activities does lclat1 exhibit?

Lclat1 demonstrates multiple enzymatic activities that contribute to its physiological roles:

  • Acyl-CoA:lysocardiolipin acyltransferase (ALCAT) activity: Catalyzes the reacylation of lyso-cardiolipin to cardiolipin, recognizing both monolysocardiolipin and dilysocardiolipin as substrates .

  • Substrate preference: Shows preferential activity with linoleoyl-CoA and oleoyl-CoA as acyl donors in the remodeling process .

  • 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT) activity: Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone .

  • Dual lysophospholipid acyltransferase capabilities: Possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities .

These multiple functional capacities explain why lclat1 plays crucial roles in various aspects of phospholipid metabolism and cellular development.

How does lclat1 influence zebrafish hematopoietic and endothelial development?

Lclat1 has been identified as a critical factor in the development of both hematopoietic and endothelial lineages in zebrafish, acting at the earliest stages of hemangioblast development. The experimental evidence supporting this role includes:

  • Knockdown studies: Reduction of lclat1 mRNA levels in wild-type zebrafish embryos using morpholinos (MO1, MO2, or MO3) results in significant decreases in both endothelial and hematopoietic lineages, as evidenced by reduced expression of lineage markers such as flk1, fli1, scl, and gata1 .

  • Rescue experiments: Introduction of lclat1 mRNA rescues blood lineages in zebrafish cloche mutant embryos and reverses the morpholino-induced reduction of flk1- and gata1-expressing cells in injected embryos .

  • Epistasis analysis: Genetic studies support that lclat1 acts upstream of scl and etsrp in zebrafish hemangioblast development, positioning it as one of the earliest known genetic determinants in this developmental pathway .

The developmental impact of lclat1 is dose-dependent, with varying levels of knockdown resulting in proportional reductions in marker gene expression such as scl in the intermediate cell mass .

What is the significance of the cloche mutant in lclat1 research?

The cloche mutant in zebrafish serves as a critical model for understanding lclat1 function:

  • Genetic relationship: The lclat1 gene was isolated from the deletion interval of the cloche locus, a zebrafish mutant characterized by dramatically reduced hematopoietic and endothelial cell lineages .

  • Phenotypic correlation: Transheterozygous zebrafish crosses from any two of three cloche alleles (clofv087b, clom39, and clom378) produce 25% identical cloche mutant embryos, confirming their allelic nature .

  • Expression analysis: Homozygous cloche embryos exhibit significantly reduced fli1 expression in vessels, similar to the phenotype observed in lclat1 morphants (particularly with MO2 or MO3) .

  • Developmental significance: The cloche mutation has been established through genome-wide microarray analyses to specifically regulate a panel of hematopoietic and endothelial genes, positioning it at the earliest stage of hemangioblast development .

These findings collectively establish cloche as a valuable genetic model for investigating lclat1 function in developmental processes.

What techniques are available for studying lclat1 function in zebrafish?

Several established methodologies are effective for investigating lclat1 function in zebrafish:

  • Morpholino-mediated knockdown: Multiple morpholinos (MO1, MO2, MO3) have been validated for reducing lclat1 expression, with documented effects on downstream markers including flk1, fli1, scl, lmo2, and gata1 .

  • RNA in situ hybridization: This technique allows visualization of spatial expression patterns of lclat1 and related genes (flk1, fli1, etsrp, scl, lmo2, gata1) in developing embryos .

  • Reverse Transcription-PCR: Both semiquantitative PCR using Qiagen Taq polymerases and quantitative PCR with TaqMan or SYBR Green probes have been successfully applied to measure lclat1 expression levels .

  • mRNA rescue experiments: Introduction of exogenous lclat1 mRNA can rescue phenotypes in both cloche mutants and morpholino-injected embryos, providing a powerful tool for functional validation .

  • Transgenic reporter lines: Lines such as Tg(flk1:GFP) and Tg(gata1:GFP) are valuable for monitoring the development of endothelial and hematopoietic lineages, respectively, when crossed with heterozygous cloche fish .

These complementary approaches provide robust methods for comprehensive functional analysis of lclat1 in developmental contexts.

How can mutations in lclat1 catalytic domains be studied?

Specific mutations in the catalytic domain of lclat1 provide valuable insights into structure-function relationships:

  • Site-directed mutagenesis: E165R and G166L mutations in the highly conserved catalytic domain have been shown to abolish lclat1 function in zebrafish hematopoiesis .

  • Functional assessment: These mutations can be introduced into lclat1 expression constructs, followed by mRNA synthesis and injection into embryos to assess their impact on rescue capability .

  • Enzymatic activity assays: The impact of mutations on enzymatic function can be assessed using in vitro assays with lysocardiolipin as a substrate, as demonstrated with the mouse Lycat ortholog .

  • Conservation analysis: The high conservation of the catalytic domain across species facilitates comparative studies between zebrafish lclat1 and its orthologs, such as mouse Lycat, which has been shown to function as a bona fide ortholog in zebrafish rescue experiments .

This approach to studying catalytic domain mutations provides mechanistic insights into how structural alterations affect protein function and developmental outcomes.

How can recombinant Danio rerio lclat1 be optimally produced and purified?

Production of high-quality recombinant Danio rerio lclat1 requires careful consideration of expression systems and purification strategies:

  • Expression systems: Multiple host systems have been validated for lclat1 expression, including:

    • Cell-free expression systems

    • E. coli

    • Yeast

    • Baculovirus

    • Mammalian cell systems

  • Construct design: For optimal expression, inclusion of appropriate purification tags (His, GST, or MBP) while avoiding interference with the C-terminal endoplasmic reticulum localization signal is recommended .

  • Purification protocols: Standard purification procedures achieving ≥85% purity as determined by SDS-PAGE have been established . This typically involves:

    • Initial capture using affinity chromatography

    • Further purification via ion-exchange and/or size-exclusion chromatography

    • Quality assessment by SDS-PAGE and Western blotting

  • Activity preservation: Particular attention must be paid to maintaining the native conformation and enzymatic activity, especially considering lclat1's transmembrane nature and multiple enzymatic functions .

This methodological framework ensures production of functional recombinant protein suitable for downstream applications including enzymatic assays and structural studies.

What experimental approaches can elucidate lclat1's position in developmental regulatory networks?

Deciphering lclat1's position in developmental regulatory networks requires integrated experimental approaches:

  • Epistasis analysis: Previous studies have established that lclat1 acts upstream of scl and etsrp in zebrafish hemangioblast development . Further epistasis experiments with other early developmental regulators can refine this hierarchical positioning.

  • Chromatin immunoprecipitation (ChIP): This technique can identify direct transcriptional targets of factors downstream of lclat1, such as scl and etsrp, helping to construct the regulatory cascade.

  • RNA-seq following lclat1 modulation: Transcriptome analysis after lclat1 knockdown or overexpression at different developmental timepoints can identify direct and indirect targets, establishing the temporal sequence of regulatory events.

  • Integrated multi-omics: Combining transcriptomics with proteomics and metabolomics following lclat1 manipulation can provide a comprehensive view of how lclat1's enzymatic activities influence broader cellular processes during development.

  • Single-cell analysis: Techniques such as single-cell RNA-seq of developing zebrafish embryos with modulated lclat1 expression can reveal cell-type specific effects and identify transitional cell states during lineage specification.

These approaches collectively enable construction of a detailed regulatory model positioning lclat1 within the complex network governing hematopoietic and endothelial development.

How does zebrafish lclat1 compare functionally to mammalian orthologs?

Functional conservation between zebrafish lclat1 and its mammalian counterparts reveals important evolutionary relationships:

  • Cross-species rescue: Mouse Lycat mRNA can rescue morpholino-induced reduction of flk1- and gata1-expressing cells in zebrafish embryos, confirming that mouse Lycat is a functional ortholog of zebrafish lclat1 .

  • Expression pattern conservation: The mouse homolog of Lycat is strongly expressed in the heart and is enriched in the Flk1+/Scl− and Flk1+/Scl+ hemangioblast populations in embryoid bodies, mirroring the developmental significance observed in zebrafish .

  • Structural conservation: Both mouse and zebrafish lycat genes encode transmembrane acyltransferases with C-terminal endoplasmic reticulum localization signals, suggesting conserved subcellular localization and function .

  • Enzymatic activity: The mouse Lycat protein exhibits acyltransferase enzymatic activities using lysocardiolipin as a substrate, similar to the activities observed in zebrafish lclat1 .

FeatureZebrafish lclat1Mouse LycatHuman LCLAT1
Alternative nameslycat, lycat1, zgc:77380, wu:fj17g04Alcat1, Gm91, Lycat, Agpat8, AI181996AGPAT8, ALCAT1, LYCAT, 1AGPAT8, UNQ1849, HSRG1849
Subcellular localizationEndoplasmic reticulumEndoplasmic reticulumCytosol, endoplasmic reticulum
Developmental roleEssential for hematopoietic and endothelial lineagesRequired for hemangioblast developmentAssociated with hematopoietic development
Cross-species rescue-Can rescue zebrafish lclat1 knockdownNot reported

This evolutionary conservation underscores the fundamental importance of lclat1/Lycat function across vertebrate species.

What disease associations have been identified for LCLAT1 orthologs?

While the zebrafish model primarily elucidates developmental functions, human LCLAT1 has important disease associations:

  • Chromosome 1Q41-Q42 Deletion Syndrome: LCLAT1 has been implicated in this chromosomal deletion syndrome, which presents with developmental abnormalities .

  • Barth Syndrome: Given LCLAT1's role in cardiolipin remodeling, it has associations with Barth Syndrome, a genetic disorder characterized by cardiomyopathy, skeletal myopathy, growth retardation, neutropenia, and abnormal cardiolipin metabolism .

  • Hematopoietic disorders: Based on functional studies in zebrafish and mouse models, disruptions in LCLAT1 function may contribute to hematopoietic disorders, although direct clinical evidence in humans requires further investigation .

The conservation of LCLAT1 function across species makes the zebrafish an excellent model for investigating these disease mechanisms, particularly for developmental aspects that are challenging to study directly in humans.

How might studying lclat1 advance stem cell and regenerative medicine research?

The critical role of lclat1 in hemangioblast development suggests several promising applications in stem cell research:

  • Directed differentiation protocols: Manipulation of lclat1 expression or activity might enhance the efficiency of directed differentiation of pluripotent stem cells toward hematopoietic and endothelial lineages, with applications in both basic research and therapeutic development .

  • Regenerative medicine: Understanding how lclat1 influences cell fate decisions could inform strategies for promoting tissue regeneration, particularly in vascular and hematopoietic tissues following injury or disease .

  • Disease modeling: Recombinant lclat1 could be used in conjunction with patient-derived induced pluripotent stem cells (iPSCs) to model and investigate developmental disorders affecting hematopoietic and endothelial lineages .

  • Phospholipid metabolism in stem cell biology: Given lclat1's enzymatic functions in phospholipid metabolism, exploration of how these activities influence stem cell maintenance, differentiation, and function could reveal novel regulatory mechanisms in stem cell biology .

These research directions highlight the potential translational impact of fundamental studies on lclat1 function in developmental and regenerative contexts.

What technical challenges remain in lclat1 research?

Despite significant progress, several technical challenges persist in lclat1 research:

  • Structural characterization: The transmembrane nature of lclat1 presents challenges for high-resolution structural studies, limiting our understanding of its precise catalytic mechanisms and substrate interactions .

  • Tissue-specific functions: While broadly implicated in hematopoietic and endothelial development, the tissue-specific functions and regulatory mechanisms of lclat1 remain incompletely characterized .

  • Metabolomic integration: Connecting lclat1's enzymatic activities in phospholipid metabolism to broader cellular processes and developmental outcomes requires integration of metabolomic data with functional studies .

  • Therapeutic targeting: Development of small molecules or other approaches to specifically modulate lclat1 activity in vivo presents significant challenges but could offer novel therapeutic strategies for related disorders .

Addressing these challenges will require interdisciplinary approaches combining advanced imaging, biochemical characterization, and in vivo functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.