Recombinant Danio rerio Magnesium transporter protein 1 (magt1)

Shipped with Ice Packs
In Stock

Description

Introduction to Magt1

Magnesium Transporter 1 (Magt1) belongs to a conserved family of magnesium transporters found in all animals . The Danio rerio (zebrafish) variant shares significant homology with mammalian counterparts and functions as part of the magnesium transport system. Magt1 is classified within the TOG superfamily of transporters and plays essential roles in cellular magnesium homeostasis . The recombinant form of this protein enables detailed investigation of its structure and function through controlled expression systems.

Magt1 has been characterized as a critical protein involved not only in magnesium transport but also potentially in protein glycosylation pathways. Recent evidence demonstrates that one of the primary functions of Magt1 is participation in protein glycosylation, mediated through its role as a component of the oligosaccharyltransferase (OST) complex . This dual functionality highlights the multifaceted nature of this transporter in cellular biochemistry.

Evolutionary Conservation

The Magt1 protein represents an evolutionarily conserved Mg²⁺-specific ion transport facilitator. Its presence across vertebrate species indicates fundamental roles in biological processes . In zebrafish, Magt1 shares significant structural and functional similarities with human Magt1, making it a valuable model for studying magnesium transport mechanisms relevant to human physiology and disease.

Protein Structure and Expression

Recombinant Danio rerio Magt1 is available as a full-length mature protein encompassing amino acids 23-328 of the native sequence, fused with an N-terminal His tag to facilitate purification and detection . The protein is typically produced through heterologous expression in E. coli systems, allowing for controlled production and isolation of the functional transporter .

The mature Magt1 protein structure includes multiple transmembrane helices that facilitate its function as a membrane-embedded transporter. While the zebrafish variant has its specific characteristics, comparative studies with mammalian MagT1 suggest the presence of four to five transmembrane domains, with the nascent polypeptide possessing a cleavage site after the N-terminal signal sequence helix .

Expression and Purification Characteristics

Recombinant Danio rerio Magt1 is typically produced as a His-tagged fusion protein in E. coli expression systems, allowing for efficient purification through affinity chromatography approaches . The resulting protein preparation demonstrates high purity (greater than 90% as determined by SDS-PAGE analysis) and is typically supplied as a lyophilized powder for research applications .

Role in Magnesium Transport

Studies on the MagT1 family, including the zebrafish ortholog, reveal critical functions in cellular magnesium homeostasis. When expressed in appropriate systems, MagT1 proteins mediate saturable Mg²⁺ uptake with specific kinetic properties . The transport of Mg²⁺ by MagT1 has been characterized as rheogenic and voltage-dependent without time-dependent inactivation .

Relationship with TUSC3

Research has identified functional relationships between MagT1 and Tumor Suppressor Candidate 3 (TUSC3), a paralogous protein with shared evolutionary origins and complementary functions . Both proteins appear to catalyze Mg²⁺ influx across cell membranes and may function cooperatively in certain contexts.

Studies have shown that knockdown of either MagT1 or TUSC3 protein significantly lowers both total and free intracellular Mg²⁺ concentrations in mammalian cell lines . This functional redundancy suggests evolutionary pressure to maintain magnesium transport capabilities through multiple mechanisms.

Developmental Role in Zebrafish

Experimental evidence highlights the critical importance of Magt1 in zebrafish development. Morpholino knockdown of MagT1 and TUSC3 protein expression in zebrafish embryos results in early developmental arrest . These developmental defects can be rescued through two interventions: excess Mg²⁺ supplementation or the addition of mammalian mRNA encoding these proteins .

The rescue experiments provide compelling evidence that MagT1 and TUSC3 function as essential components of the vertebrate plasma membrane Mg²⁺ transport system . The observed developmental arrest following knockdown indicates that proper magnesium homeostasis is critical for early embryonic development in vertebrates.

Relationship to Human Disease Models

While the zebrafish Magt1 serves as a model system, research on human MAGT1 has revealed important disease associations. Null mutations in the human MAGT1 gene lead to X-linked immunodeficiency with Mg²⁺ defect, Epstein-Barr virus infection, and neoplasia (XMEN disease) . These findings highlight the translational significance of studying Magt1 across species.

In humans, MAGT1 localizes primarily to the endoplasmic reticulum and Golgi apparatus, where it participates in the multienzyme complex responsible for coupling N-glycans onto peptide substrates . This subcellular localization aligns with its dual role in magnesium transport and protein glycosylation.

Technical Applications and Handling

The recombinant Danio rerio Magt1 protein requires specific handling protocols to maintain optimal activity. Repeated freezing and thawing should be avoided, with working aliquots stored at 4°C for up to one week . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom, and then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

Addition of glycerol (5-50% final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended to maintain protein stability and activity . These technical considerations ensure reliable experimental outcomes when working with this recombinant protein.

Research Applications

Recombinant Danio rerio Magt1 serves as a valuable tool for various research applications, including:

  1. Structure-function studies of magnesium transport mechanisms

  2. Investigation of protein-protein interactions in magnesium homeostasis

  3. Development of screening assays for compounds affecting magnesium transport

  4. Comparative studies between fish and mammalian magnesium transport systems

  5. Generation of antibodies for detection of endogenous Magt1 in experimental systems

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
magt1; zgc:56218; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-328
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
magt1
Target Protein Sequence
QKKKETLLSEKVSQMMEWVSKRAVVRLNGEKFKRLVRAHPRNYSVIVMFTALQPQRQCGV CRQADEEYQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPK RADTYELQVRGFAAEQLARWVADRTDVHIRVIRPPNYAGPLMLGLLLAFIGSLAYLRRNN LEFLFNKNVWAFSALCFVLIMTSGQMWNHIRGPPYAHKNPNTGQVSYIHGSSQAQFVAET HIVLLFNAAVTIGMVLLHEAATSGLDIVKRKIMCVAGIGLVVLFFSWLLSVFRAKYHGYP YSFLFG
Uniprot No.

Target Background

Function
Cell surface magnesium transporter. Functions as an accessory component of the N-oligosaccharyl transferase (OST) complex, which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. It may be involved in substrate-specific N-glycosylation.
Database Links
Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and functional significance of magt1 in zebrafish?

Magnesium transporter protein 1 (magt1) in Danio rerio is a membrane protein with four predicted transmembrane (TM) helices that functions as a critical magnesium transporter . The zebrafish magt1 protein sequence (Q7ZV50) spans amino acids 23-328 of the mature protein . The protein shares approximately 80% sequence identity with its human homolog, indicating strong evolutionary conservation .

Functionally, magt1 plays an essential role in cellular magnesium uptake and is crucial for proper embryonic development in zebrafish. Knockdown studies have demonstrated that reduced magt1 expression severely impairs normal developmental progression, with morpholino-mediated suppression of both magt1 and TUSC3 (a related protein) resulting in profound developmental abnormalities and significantly reduced hatching rates in zebrafish embryos .

How can magt1 protein expression be detected in zebrafish model systems?

Detection of magt1 protein expression in zebrafish can be accomplished through several complementary approaches:

  • Western blotting: Anti-MagT1 antibodies can be used to detect the protein in homogenized zebrafish embryo lysates. This approach allows quantification of protein levels relative to control proteins like tubulin . When embryos are injected with morpholinos targeting magt1, protein levels can be reduced to approximately 10% of normal levels with Morpholino A (targeting translation initiation) and 22% with Morpholino B (targeting splicing) .

  • RT-PCR: For assessment of mRNA splicing effects, RT-PCR can be performed on total RNA from embryos, particularly when using splice-blocking morpholinos .

  • Immunohistochemistry: Localization of magt1 protein expression in tissue sections can provide spatial information about expression patterns during development.

  • Fluorescent tagging: For dynamic studies, magt1 can be tagged with fluorescent proteins to monitor subcellular localization in live embryos.

What experimental approaches can be used to study magt1 function in zebrafish development?

Several methodological approaches have been validated for studying magt1 function in zebrafish:

  • Morpholino knockdown: Two types of morpholinos can be used to reduce magt1 expression:

    • Morpholino A: Targets the translation start site, reducing both maternal and zygotic protein levels

    • Morpholino B: Targets intron-exon borders, interfering with mRNA splicing and affecting only zygotic expression

  • Rescue experiments: Co-injection of human MagT1 and TUSC3 mRNA or MgCl₂ can rescue the developmental defects caused by morpholino knockdown, confirming specificity of the observed phenotypes .

  • Hatching rate assessment: Quantifying the percentage of embryos that successfully hatch by 48 hours post-fertilization provides a functional readout of developmental progression (normal hatching rate is approximately 90% in control embryos) .

  • Morphological analysis: Observation of developmental abnormalities at 30 hours post-injection can reveal specific defects associated with magt1 deficiency .

How do magt1 and TUSC3 proteins functionally interact in magnesium transport?

Research indicates that magt1 and TUSC3 function cooperatively in magnesium transport and embryonic development. In zebrafish, knockdown of either gene alone produces distinct but related phenotypes:

  • MagT1 Morpholino A injection alone nearly completely prevents embryo hatching

  • TUSC3 Morpholino A decreases hatching rates to approximately 30%

  • Combined knockdown with Morpholino B against both MagT1 and TUSC3 reduces hatching to only 20%

This synergistic effect suggests functional redundancy between the proteins. Both proteins can complement the yeast ALR1 magnesium transporter defect, indicating their direct involvement in magnesium transport pathways . The cooperative nature of their interaction suggests that experimental designs should consider potential compensatory mechanisms when studying either protein in isolation.

Methodologically, researchers investigating this interaction should:

  • Design experiments that simultaneously manipulate both proteins

  • Include appropriate controls for single and double knockdowns

  • Consider rescue experiments with varying ratios of magt1 and TUSC3 to determine optimal functional restoration

What are the optimal conditions for expression and purification of recombinant Danio rerio magt1 protein?

Recombinant Danio rerio magt1 protein can be successfully expressed in E. coli with an N-terminal His tag spanning the mature protein region (amino acids 23-328) . Based on available protocols, the following methodological considerations are important:

  • Expression system: E. coli has been validated as an effective expression system for producing recombinant magt1 protein .

  • Purification approach: His-tag affinity chromatography can be used for initial purification, potentially followed by additional chromatography steps to achieve higher purity.

  • Storage conditions: The purified protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

  • Reconstitution protocol: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% (optimally 50%) is recommended for long-term storage at -20°C/-80°C .

  • Buffer composition: Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been established as an effective storage buffer .

What experimental approaches can differentiate between magt1's dual roles in magnesium transport and protein glycosylation?

Magt1 has been described as having dual functional roles: as a magnesium transporter at the plasma membrane and as a component of the oligosaccharyltransferase (OST) complex involved in protein glycosylation in the endoplasmic reticulum . Differentiating between these functions requires sophisticated experimental approaches:

  • Subcellular localization studies:

    • Immunofluorescence microscopy with organelle-specific markers

    • Subcellular fractionation followed by western blotting

    • Live cell imaging with fluorescently tagged magt1 variants

  • Functional assays:

    • Magnesium transport: Direct measurement of Mg²⁺ flux using fluorescent indicators (like Mag-Fura-2) or radioactive ²⁸Mg

    • Glycosylation: Analysis of N-linked glycosylation patterns using glycosidase digestion and lectin binding assays

  • Domain-specific mutations:

    • Generation of magt1 variants with mutations in domains predicted to be involved specifically in either magnesium transport or OST complex integration

    • Complementation assays in systems lacking endogenous magt1 expression

  • Interaction studies:

    • Co-immunoprecipitation to identify protein partners in different cellular compartments

    • Proximity labeling approaches (BioID or APEX) to identify compartment-specific interactors

The controversy surrounding magt1's precise function highlights the importance of complementary approaches to fully characterize its biological roles .

How do different divalent cations interact with magt1 and affect its transport function?

While magt1 primarily functions as a magnesium transporter, research on related transporters suggests it may have varying affinities for different divalent cations. Although specific data for zebrafish magt1 selectivity is limited in the provided search results, studies on related magnesium transporters provide valuable insights:

Studies on TRPM7, another magnesium transporter, have shown the following selectivity profiles:

  • In HEK293 cells: Zn²⁺ = Ni²⁺ > Ba²⁺ > Co²⁺ > Mg²⁺ ≥ Mn²⁺ > Sr²⁺ ≥ Cd²⁺ ≥ Ca²⁺

  • In CHOK1 cells: Ni²⁺ > Zn²⁺ > Ba²⁺ = Mg²⁺ > Ca²⁺ = Mn²⁺ = Sr²⁺ > Cd²⁺

Experimental approaches to characterize magt1's divalent cation selectivity should include:

  • Competition assays: Measuring Mg²⁺ transport in the presence of varying concentrations of competing divalent cations.

  • Direct transport assays: Using isotopic tracers or fluorescent indicators specific for different divalent cations.

  • Electrophysiological techniques: Patch-clamp recording to measure current changes associated with different cation permeation.

  • Binding assays: Using purified recombinant magt1 protein to determine binding affinities for different divalent cations.

Understanding cation selectivity is critical for interpreting experimental results, especially in systems where multiple divalent cations may be present simultaneously.

What structural features of magt1 determine its magnesium transport capacity?

The structural basis of magt1's magnesium transport function can be inferred from studies of related magnesium transporters. While specific structural data for zebrafish magt1 is limited in the provided search results, insights from archaeal CorB proteins (which share structural similarities with vertebrate CNNM proteins, another family of magnesium transporters) suggest important features:

  • Transmembrane domain structure: Magt1 contains a DUF21 transmembrane domain, which in archaeal CorB exists in an inward-facing conformation with a Mg²⁺ ion coordinated by a conserved π-helix .

  • ATP binding domains: The CBS-pair domain in related transporters can adopt different conformational states (elongated dimeric configuration in the absence of Mg²⁺-ATP versus a different conformation when Mg²⁺-ATP is bound) .

  • Regulatory mechanisms: Structural rearrangements mediated by Mg²⁺-ATP sensing appear to play a crucial role in transport function .

Experimental approaches to investigate structure-function relationships should include:

  • Site-directed mutagenesis of conserved residues in the transmembrane domains

  • Generation of chimeric proteins combining domains from different magnesium transporters

  • Hydrogen-deuterium exchange mass spectrometry to identify regions undergoing conformational changes during transport cycles

  • Molecular dynamics simulations to predict ion coordination sites and permeation pathways

How can recombinant magt1 protein be used in reconstituted liposome systems to study transport kinetics?

Liposome-based transport assays provide a controlled system for studying the intrinsic transport properties of magt1. Based on methodologies used for related transporters, the following protocol can be adapted for zebrafish magt1:

  • Liposome preparation:

    • Prepare liposomes using a mixture of phospholipids (typically phosphatidylcholine and phosphatidylethanolamine)

    • Incorporate purified recombinant magt1 protein (His-tagged, amino acids 23-328) during liposome formation using detergent-mediated reconstitution

  • Transport assay setup:

    • Load liposomes with a magnesium-sensitive fluorescent dye or maintain an ion gradient

    • Initiate transport by adding external magnesium or other divalent cations

    • Monitor changes in fluorescence or use a radioactive tracer approach with ²⁸Mg

  • Kinetic analysis:

    • Determine Km and Vmax values for magnesium transport

    • Assess competition by other divalent cations

    • Evaluate the effects of potential inhibitors or activators

This approach has been successfully used to demonstrate direct Mg²⁺ transport by CorB proteins, which are structurally related to magt1 . The methodology allows for precise control of both internal and external ionic conditions, enabling detailed characterization of transport mechanisms and regulation.

What are the developmental consequences of magt1 deficiency in zebrafish, and how do they inform human disease models?

Morpholino-mediated knockdown of magt1 in zebrafish embryos reveals its critical importance in early development:

  • Developmental phenotypes:

    • MagT1 Morpholino A (targeting translation initiation) completely abrogates embryo hatching

    • Combined knockdown of MagT1 and TUSC3 results in profound developmental abnormalities visible by 30 hours post-injection

    • Only 5% of embryos hatch when treated with combined Morpholino A against both MagT1 and TUSC3

  • Rescue experiments:

    • Co-injection with human MagT1 and TUSC3 mRNA partially restores normal development

    • MgCl₂ supplementation can also partially rescue the phenotype, confirming the magnesium transport function

  • Translation to human diseases:

    • Mutations in human MAGT1 have been linked to a glycosylation disorder with intellectual disability and developmental delay

    • Some MAGT1 mutations cause X-linked immunodeficiency with magnesium defect, chronic Epstein-Barr virus infection, and neoplasia (XMEN)

    • The zebrafish model provides a platform to test the functional consequences of patient-derived MAGT1 mutations

Methodologically, researchers should consider:

  • Using CRISPR/Cas9 genome editing as an alternative to morpholinos for creating stable magt1-deficient zebrafish lines

  • Employing tissue-specific conditional knockdown approaches to distinguish developmental from physiological roles

  • Conducting detailed phenotypic analyses across multiple organ systems to identify all affected tissues

What methods can be used to assess magnesium homeostasis in zebrafish magt1 models?

Evaluating magnesium homeostasis in zebrafish models with altered magt1 expression requires specialized techniques:

  • Tissue magnesium measurements:

    • Inductively coupled plasma mass spectrometry (ICP-MS) for precise quantification of tissue magnesium content

    • Colorimetric assays using magnesium-sensitive dyes for relative comparisons

  • Spatial distribution analysis:

    • Electron probe microanalysis for subcellular magnesium localization

    • Fluorescent magnesium indicators (like Mag-Fura-2) for live imaging of magnesium distributions in tissues

  • Functional assessments:

    • Measurement of magnesium-dependent enzyme activities as functional readouts of intracellular magnesium availability

    • Electrophysiological recordings of magnesium-sensitive channels and transporters

  • Genetic interactions:

    • Analysis of gene expression changes in other magnesium transporters (like TRPM6/7) as compensatory responses

    • Assessment of genetic interactions through combined knockdown/knockout approaches

  • Rescue experiments:

    • Controlled magnesium supplementation studies to determine the threshold for phenotypic rescue

    • Tissue-specific reconstitution of magt1 expression to map critical sites of action

These approaches should be applied in both acute knockdown models (morpholinos) and stable genetic models (CRISPR/Cas9-generated mutants) to distinguish between developmental and physiological roles of magt1 in magnesium homeostasis.

How can zebrafish magt1 models contribute to understanding the dual functionality of MAGT1 in human disease?

The zebrafish magt1 model offers unique advantages for dissecting the complex roles of MAGT1 in human pathophysiology:

  • Comparative analysis of different disease phenotypes:

    • Some MAGT1 mutations cause primarily immunological defects (XMEN disease), while others lead to intellectual disability and developmental delay

    • Zebrafish models can help determine whether these distinct phenotypes arise from differential effects on magnesium transport versus glycosylation functions

  • Structure-function correlations:

    • Introduction of patient-specific mutations into zebrafish magt1 can reveal which protein domains are critical for each function

    • Rescue experiments with domain-specific mutant constructs can identify the molecular basis of different disease presentations

  • Therapeutic screening:

    • The zebrafish model provides a platform for testing interventions that might selectively restore either magnesium transport or glycosylation functions

    • High-throughput screening approaches can identify compounds that rescue specific phenotypic aspects

  • Developmental timing analysis:

    • The accessibility of zebrafish embryos allows precise temporal manipulation of magt1 function

    • This can reveal critical developmental windows where magt1 function is essential, informing potential intervention timing in human conditions

By leveraging the 80% sequence identity between zebrafish and human MAGT1 , researchers can develop translational insights with direct relevance to human disease mechanisms and potential therapeutic approaches.

What cutting-edge techniques can be applied to study the interactome of magt1 in different cellular compartments?

Understanding magt1's protein interaction network across different cellular compartments can provide critical insights into its dual functionality. Advanced methodological approaches include:

  • Proximity-dependent labeling:

    • BioID or TurboID: Fusion of a biotin ligase to magt1 to identify proximal proteins

    • APEX2: Peroxidase-based proximity labeling for temporal and spatial resolution of interactions

    • Split-BioID: For detecting interactions that occur only in specific cellular contexts

  • Crosslinking mass spectrometry (XL-MS):

    • In vivo crosslinking to capture transient interactions

    • MS analysis to identify crosslinked peptides, revealing spatial relationships between interacting proteins

  • Organelle-specific interactome analysis:

    • Subcellular fractionation combined with immunoprecipitation and mass spectrometry

    • Comparative analysis of interactions in endoplasmic reticulum versus plasma membrane fractions

  • Live-cell interaction mapping:

    • Förster resonance energy transfer (FRET) to visualize interactions in real-time

    • Split-fluorescent protein complementation to detect specific interaction partners in different cellular compartments

  • Functional interactome perturbation:

    • siRNA/shRNA screens targeting potential interactors followed by functional assessments

    • CRISPR interference/activation screens to identify genetic modifiers of magt1 function

These approaches can help resolve the controversy regarding magt1's role as an endoplasmic reticulum-localized subunit of the oligosaccharyltransferase complex versus its function as a plasma membrane magnesium transporter .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.