Recombinant Danio rerio Melatonin receptor type 1B-A (mtnr1ba)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mtnr1ba is synthesized using heterologous expression systems optimized for high yield and functional fidelity:

  • Expression: Cloned into plasmid vectors under strong promoters (e.g., T7) and expressed in E. coli BL21 strains .

  • Purification: Immobilized metal affinity chromatography (IMAC) leveraging the His-tag, followed by size-exclusion chromatography for monomeric isolation .

  • Quality Control: Validated via Western blot, ligand-binding assays (e.g., 2-(125I)-iodomelatonin), and functional cAMP inhibition tests .

Signaling Pathways

  • Melatonin Binding: Exhibits high affinity for melatonin (Kd ~0.1–1 nM), triggering Gαi-mediated inhibition of adenylate cyclase and reduced cAMP production .

  • Circadian Regulation: Modulates light-dependent retinal functions and suprachiasmatic nucleus activity in zebrafish, mirroring roles observed in mammals .

  • Disease Relevance: Orthologous human MTNR1B variants (e.g., p.Ala42Pro, p.Leu60Arg) disrupt receptor function and correlate with type 2 diabetes risk, suggesting conserved metabolic roles .

Experimental Applications

  • Drug Discovery: Used in high-throughput screens for melatonin receptor agonists/antagonists .

  • Developmental Studies: Zebrafish models exploit mtnr1ba to study embryogenesis and neurobehavioral rhythms .

  • Structural Biology: Facilitates cryo-EM and X-ray crystallography studies to resolve GPCR activation mechanisms .

Comparative Analysis with Zebrafish Paralogs

Zebrafish possess duplicated melatonin receptor genes due to teleost-specific whole-genome duplication (3R event) . Key paralogs include:

ReceptorGeneUniProt IDExpression PatternFunctional Distinction
MTNR1B-Amtnr1baQ90456Diencephalon, midbrain Linked to circadian entrainment
MTNR1B-Bmtnr1bbP51049Retina, pineal gland Enhanced light sensitivity
MTNR1Amtnr1aa-Widespread in CNS Redundant roles in melatonin signaling

Type 2 Diabetes Link

  • Rare MTNR1B loss-of-function variants (e.g., p.Tyr308Ser) impair receptor signaling and elevate diabetes risk (OR = 3.88; P = 5.37×10⁻³) .

  • Zebrafish mtnr1ba knockouts exhibit glucose intolerance, validating conserved metabolic roles .

Chronobiology

  • Diurnal expression patterns in zebrafish brain correlate with melatonin secretion cycles, supporting evolutionary conservation of circadian regulation .

Future Directions

  • CRISPR/Cas9 Models: Generating tissue-specific mtnr1ba mutants to dissect its role in zebrafish metabolism .

  • Therapeutic Targeting: Developing subtype-selective melatonin analogs using zebrafish receptor structures .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage state, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag type if feasible.
Synonyms
mtnr1ba; mel1b; mtnr1b; Melatonin receptor type 1B-A; Mel-1B-R-A; Mel1b receptor A; Melatonin receptor Mel1b Z6.2; Melatonin receptor Mel1b-19; zMel1b-2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
mtnr1ba
Target Protein Sequence
MPENVSLIRNRTEVGQGRAWGSGAGARPAWVVMVLAGVLIFTSVVDVLGNVLVIISVLRN RKLRNAGNAFVVSLAFADLLVVCYPYPLVLHAMLHAGWLPGEMECKVSGFLMGASVIGSI FNITAIAINRYCFICQANTYEKIYGRAGTLVLLTLVWVLTAIAILPNLSLGSLTYDPRVY SCTFSQTTSAGYTIAVVTVHFLLPIAVVTFCYLRIWVLVLRVRRRVTTDVRPRLRPSELR HFLTMFVVFVLFAVCWAPLNLIGLAVAVDPPRVGPLVPDWLFVMSYF
Uniprot No.

Target Background

Function
High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin-sensitive G proteins that inhibit adenylate cyclase activity.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.