Recombinant Danio rerio Membrane progestin receptor alpha-B (paqr7b)

Shipped with Ice Packs
In Stock

Description

Functional Role in Progestin Signaling

Mechanism of Action

  • Ligand Binding: Binds progesterone and related progestins with high affinity (Kd=48 nMK_d = 4–8\ \text{nM}) .

  • G Protein Coupling: Activates inhibitory G proteins (GiG_i), reducing intracellular cAMP levels .

  • Physiological Functions:

    • Mediates oocyte maturation and sperm hypermotility in zebrafish .

    • Regulates neuroendocrine functions and gamete transport in vertebrates .

Key Interactions

  • PGRMC1 Association: Requires progesterone receptor membrane component 1 (PGRMC1) for cell-surface localization and signaling .

  • Ligand Specificity: Binds allopregnanolone (a neurosteroid) at 7.6% affinity relative to progesterone .

Research Applications

Experimental Uses

  • Ligand-Binding Assays: Utilized to study progestin receptor kinetics and antagonist screening (e.g., 2-HPA from Padina algae) .

  • Functional Studies: CRISPR/Cas9 knockout models reveal its role in reduced spawning frequency and embryo production in zebrafish .

  • Antibody Development: Polyclonal antibodies against Paqr7B enable immunohistochemistry and Western blotting .

Table 1: Comparative Binding Affinities of Paqr7B Ligands

LigandRelative Binding Affinity (%)Functional Outcome
Progesterone100cAMP inhibition, oocyte maturation
Allopregnanolone7.6Neuroprotective effects
17α,20β-DHP95Sperm hypermotility

Research Findings and Implications

  • Reproductive Dysregulation: Paqr7b knockout zebrafish exhibit impaired oocyte maturation due to disrupted progesterone-PGRMC1-mPRα signaling .

  • Therapeutic Potential: Targeting Paqr7B could modulate reproductive disorders or cancers reliant on progestin pathways .

  • Evolutionary Conservation: Structural and functional homology with human PAQR7 highlights its utility in cross-species studies .

References

Citations are embedded throughout the text using numerical identifiers corresponding to the provided search results .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is preferred, please inform us in advance as an additional fee will be applied.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
paqr7b; mpra; paqr7; Membrane progestin receptor alpha-B; mPR alpha; Progestin and adipoQ receptor family member VII, b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
paqr7b
Target Protein Sequence
MATVVMEQIGRLFINAQQLRQIPRFLESAFPKLPCTVMVSDVPWVFRESHIITGYRPPDQ NWRYYFLTLFQRHNESVNVWTHLLASLIILVKFQELSETVDFLRDPHAQPMFILLLAAFT YLGCSALAHLLSAKSEISHYTFYFLDYVGVAVYQYGSALAHFYYVVEEEWHAQVRTFFLP ASAFLAWLSCTGCCYGKYASPKLPKFVHKLFQVVPSGLAYCLDISPVLHRIYRCYSSEHW CADQAVVYHCYQVLFFLISAYFFSYPHPERWFPGRCDFIGQGHQIFHVFLVLCTLVQIEA VRLDYTERRRLYEHLHGDLAHDAVALFIFTACCSALTAFYVRKRVKTYLEEKQE
Uniprot No.

Target Background

Function
Membrane progestin receptor alpha is a steroid membrane receptor. It signals upon progestin binding, resulting in rapid activation of MAPK and down-regulation of adenylyl cyclase activity. The receptor exhibits affinity for various steroids, demonstrating specificity for activation by the maturation-inducing steroid (MIS) 4-pregnen-17,20beta-diol-3-one (17,20beta-DHP). It plays a role in mediating progestin-induced oocyte maturation.
Gene References Into Functions
  1. Membrane progestin receptor alpha is the long-sought-after nongenomic progestin receptor responsible for deciphering extracellular non genomic progestin signaling to initiate meiosis resumption in follicle-enclosed zebrafish oocytes PMID: 21335056
  2. Progestin receptor mediates a nonclassical action of progestins to induce oocyte maturation in fish PMID: 12574519
Database Links
Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is paqr7b and what is its role in zebrafish?

Paqr7b (progestin and adipoQ receptor family member VII, b) encodes the membrane progestin receptor alpha-B (mPRα) in zebrafish (Danio rerio). This protein belongs to the progestin and adipoQ receptor (PAQR) family, which consists of 11 genes . Functionally, paqr7b enables nuclear steroid receptor activity and steroid binding. It's involved in the adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway, positive regulation of MAPK cascade, and steroid hormone receptor signaling pathway . Most significantly, it plays a critical role in oocyte maturation and meiosis resumption in zebrafish through a progestin-mediated pathway .

What is the relationship between paqr7b and progesterone signaling?

Paqr7b functions as a membrane progesterone receptor, mediating rapid, non-genomic progesterone signaling. In zebrafish, it specifically mediates 17,20β-dihydroxy-4-pregnen-3-one (DHP) induction of oocyte maturation. The receptor operates through an mPRα/Gi/Erbb2 signaling pathway that requires another protein, Pgrmc1, for expression on oocyte membranes . The relative potencies of progestins and specific mPRα agonists in inducing oocyte maturation match their relative binding affinities for zebrafish mPRα, supporting its role as the primary receptor mediating this process .

How can recombinant paqr7b be used in zebrafish oocyte maturation studies?

Recombinant paqr7b can be used in several experimental approaches to study oocyte maturation:

  • Binding assays: To determine the binding affinity of various progestins and specific mPRα agonists to characterize receptor-ligand interactions.

  • Signaling studies: To investigate the G-protein (specifically Gi) signaling pathway activated by mPRα, including effects on cyclic AMP levels.

  • Protein-protein interaction studies: To examine interactions between mPRα and other proteins, particularly Pgrmc1 and Erbb2, using techniques such as in situ proximity ligation assays .

  • Structure-function analyses: To identify critical domains of the receptor that mediate specific functions through site-directed mutagenesis followed by functional assays.

What are the optimal storage conditions for recombinant paqr7b?

For optimal stability, recombinant paqr7b should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C. The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for protein stability. Repeated freezing and thawing should be avoided as this can compromise protein integrity. For short-term work, aliquots can be stored at 4°C for up to one week .

Storage ConditionRecommended DurationNotes
-80°CLong-term storagePreferred for extended periods
-20°CStandard storageSuitable for most research applications
4°CUp to one weekWorking aliquots only

What zebrafish models are available for studying paqr7b function?

Researchers have developed several zebrafish models to study paqr7b function:

  • Knockout models: Global knockout of paqr7b can be generated using CRISPR-Cas9 technology to study its physiological roles. Knockouts allow for investigation of phenotypes related to reproduction, embryonic development, and hormone signaling .

  • Morpholino knockdown: Microinjection of morpholino antisense oligonucleotides targeting paqr7b has been used to study its role in oocyte maturation. This approach has demonstrated that knockdown of paqr7b prevents DHP-induced oocyte maturation .

  • Transgenic reporter lines: These can be used to visualize paqr7b expression patterns during development and in various tissues.

  • Wild-type expression studies: Wild-type zebrafish can be used to study the natural expression patterns of paqr7b across various tissues including brain, gill, gonad, intestine, and sperm .

How does paqr7b interact with Pgrmc1 in the context of oocyte maturation?

The interaction between paqr7b (mPRα) and Pgrmc1 represents a complex signaling mechanism:

  • Co-localization and physical interaction: In situ proximity ligation assays have detected close associations between Pgrmc1 and mPRα in zebrafish oocytes, suggesting physical proximity or direct interaction .

  • Pgrmc1 as an adaptor protein: Evidence suggests that Pgrmc1 functions as an adaptor protein required for the expression of mPRα on oocyte membranes. Knockdown of Pgrmc1 using morpholino antisense oligonucleotides blocked DHP-induced oocyte maturation, accompanied by decreased levels of both Pgrmc1 and mPRα on the oocyte plasma membranes .

  • Signaling pathway integration: Pgrmc1 appears to integrate signals between mPRα and Erbb2, as close associations between Pgrmc1 and Erbb2 have also been detected. Treatment with the Pgrmc1 inhibitor AG205 reversed the inhibitory effects of Erbb2 inhibitors on oocyte maturation, indicating complex pathway interactions .

  • Knockout effects: Studies with Pgrmc1 knockout zebrafish (pgrmc1−/−) showed reduced sensitivity of fully-grown immature oocytes to progestin hormone and a reduced number of oocytes undergoing meiotic maturation both in vivo and in vitro. This corresponds with significantly reduced expression of mPRα in these knockouts .

What are the differences between paqr7b and other membrane progestin receptor subtypes?

The membrane progestin receptor family in zebrafish includes multiple subtypes with distinct characteristics:

Receptor SubtypeGeneKey FeaturesPrimary Functions
mPRα-Bpaqr7b354 amino acids, primary mPR in oocytesMediates oocyte maturation, G-protein signaling
mPRγpaqr5bEssential for neuronal developmentFormation of neurons in olfactory rosettes
Other mPRsVarious paqr genesTissue-specific expressionDiverse physiological roles

Notably, a recent study established knockout zebrafish strains by genetically editing seven paqr genes. The paqr5b (mPRγ) null-mutant showed distinct phenotypes from paqr7b, including defects in olfactory rosette development, demonstrating the non-redundant functions of different mPR subtypes .

How do experimental variables affect zebrafish development and paqr7b function studies?

Several experimental variables can significantly impact zebrafish development studies and investigations of paqr7b function:

  • Protocol parameters:

    • Chorion status (with vs. without) significantly affects compound exposure and developmental outcomes

    • Static vs. static renewal (repeated exposure) dosing scenarios influence toxicity outcomes

    • Exposure duration and concentration dramatically affect behavioral and developmental responses

  • Zebrafish strain differences:

    • Different laboratory strains (e.g., 5D Tropical vs. others) may show varied responses in development and behavior

    • Genetic background can influence expression and function of paqr7b

  • Experimental design variations:

    • Exposure volume (96-well vs. larger containers)

    • Timing of exposure (early vs. late developmental stages)

    • Duration of observation period

One study analyzing data from three independent laboratories found that when protocols with different parameters were compared, the concordance dropped, and the potency shift was on average about 3.8-fold for developmental toxicity outcomes and 5.8-fold for neurotoxicity outcomes .

What techniques are most effective for studying paqr7b signaling pathways?

Several techniques have proven effective for investigating paqr7b signaling:

  • Microinjection of pertussis toxin: This has been used to block DHP induction of oocyte maturation and progestin-induced decrease in cyclic AMP levels, demonstrating that mPRα activates an inhibitory G protein (Gi) .

  • In situ proximity ligation assays: These have successfully detected close associations between paqr7b and other proteins (Pgrmc1, Erbb2) in zebrafish oocytes, providing evidence for physical interactions .

  • Pharmacological inhibitors: Compounds such as AG205 (a PGRMC1 inhibitor), ErbB2 inhibitor II, and AG 879 have been used to probe the interactions between paqr7b and other signaling molecules .

  • Cyclic AMP assays: These measure changes in second messenger levels following receptor activation, providing direct evidence of G protein-coupled receptor signaling.

  • Western blot analysis: This technique has been used to confirm expression of mPRα, Pgr, and Pgrmc1 in fully-grown Stage IVa immature follicles using characterized polyclonal zebrafish antibodies .

How should zebrafish oocyte maturation assays be designed when studying paqr7b function?

For effective zebrafish oocyte maturation assays studying paqr7b function:

  • In vitro assay protocol:

    • Collect fully-grown Stage IVa follicles from adult zebrafish

    • Incubate oocytes in zebrafish Ringer's solution

    • Add test compounds (e.g., DHP at 1 μM final concentration)

    • After two hours of incubation, determine the percentage of germinal vesicle breakdown (%GVBD) by scoring oocytes that become transparent

    • Perform assays in triplicate using oocytes from at least three fish

  • In vivo assay protocol:

    • Add test compounds to the water at appropriate concentrations (e.g., 0.1 μM)

    • After four hours of incubation, determine %GVBD and %ovulation

    • Score oocytes as they become transparent and form an egg membrane

    • Use multiple fish per treatment (minimum of three)

  • Critical controls:

    • Vehicle control (typically ethanol or DMSO at ≤0.1%)

    • Positive control (DHP alone)

    • Negative control (no treatment)

    • Additional controls with inhibitors when studying specific pathway components

What are the best practices for ensuring ethical treatment of zebrafish in paqr7b research?

Ethical considerations for zebrafish in paqr7b research should follow the three Rs principle (refinement, replacement, and reduction):

  • Refinement:

    • Use methods that alleviate or minimize potential pain, suffering, or distress

    • Ensure proper anesthesia during procedures using approved methods

    • Train personnel properly in zebrafish handling and procedures

  • Replacement:

    • Consider in vitro cell culture assays when possible, though results may not always generate actual forecasts compared with in vivo results

    • Use early-stage embryos when possible (pre-hatching stages have fewer ethical concerns)

  • Reduction:

    • Minimize the number of animals while ensuring statistical significance

    • Design experiments to maximize data obtained from each animal

    • Consider statistical power analyses to determine minimum sample sizes needed

  • Specific considerations for euthanasia:

    • Rapid chilling may be applied to adults, larvae, and embryos

    • Rapid freezing should only be performed on anesthetized animals

    • Other methods should follow institutional and national guidelines

How should researchers interpret contradictory results between different zebrafish paqr7b studies?

When faced with contradictory results between different zebrafish paqr7b studies, researchers should consider:

  • Protocol parameter differences:

    • One study analyzing developmental toxicity data found that laboratories with similar protocol parameters had active call concordance as high as 86%, but those with different parameters had much lower concordance

    • Key parameters that affect results include chorion status, dosing scenario, exposure duration, and zebrafish strain

  • Laboratory environment variations:

    • Housing conditions, including stocking densities and specific feed types, can influence zebrafish physiology

    • Environmental stressors like noise and transportation significantly impact behavior and potentially hormone signaling

  • Sex differences:

    • Female zebrafish exhibit different behaviors than males, which could impact studies involving hormone receptors like paqr7b

    • Studies should always report and account for sex as a variable

  • Different knockout/knockdown approaches:

    • Morpholino knockdowns may have off-target effects not present in CRISPR-Cas9 knockouts

    • Timing of genetic manipulation can affect developmental compensation

Researchers should clearly report all methodology details and consider replicating key findings using multiple approaches.

What are common pitfalls when working with recombinant paqr7b and how can they be avoided?

Common pitfalls and solutions when working with recombinant paqr7b include:

  • Protein stability issues:

    • Pitfall: Loss of activity due to improper storage or handling

    • Solution: Store at recommended temperature (-20°C or -80°C); avoid repeated freeze-thaw cycles; use working aliquots at 4°C for up to one week only

  • Improper reconstitution:

    • Pitfall: Protein aggregation or denaturation during reconstitution

    • Solution: Follow manufacturer's protocol precisely; use recommended buffers; avoid vigorous agitation

  • Experimental design inconsistencies:

    • Pitfall: Variability between experiments due to protocol differences

    • Solution: Standardize protocols; document all parameters; include appropriate controls in each experiment

  • Antibody cross-reactivity:

    • Pitfall: Non-specific antibody binding leading to false positives

    • Solution: Validate antibodies using knockout controls; use previously characterized polyclonal zebrafish antibodies

  • Functional assay sensitivity:

    • Pitfall: Insufficient sensitivity to detect subtle functional changes

    • Solution: Optimize assay conditions; include positive controls; perform dose-response studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.