Recombinant Danio rerio Membrane progestin receptor gamma-A (paqr5a)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Zebrafish Physiology

paqr5a is implicated in progesterone signaling and reproductive processes:

  • Oocyte Maturation: Interacts with PGRMC1 (Progesterone Receptor Membrane Component 1) to regulate progesterone binding and downstream signaling in ovarian follicles .

  • Neurosteroid Actions: Modulates neurosteroid effects on apoptosis inhibition in brain tissues .

  • Developmental Regulation: High kidney-specific expression suggests potential roles in renal development or function .

Key Functional Interactions

Partner ProteinInteraction MechanismBiological Outcome
PGRMC1Forms heterodimers to stabilize mPRα/paqr5aEnhances progesterone binding capacity .
G proteinsCouples via inhibitory Gαi subunitsDownregulates cAMP signaling .

Biochemical and Recombinant Production

The recombinant form is produced in E. coli with the following specifications :

ParameterDetail
Expression SystemEscherichia coli (E. coli)
TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in deionized water; 50% glycerol for long-term storage

4.1. Ligand Binding and Mutational Studies

  • Progesterone Affinity: Recombinant paqr5a binds progesterone with high affinity (Kd ≈ 4–8 nM) in eukaryotic systems .

  • Q206 Mutagenesis: Substitution of Q206 with alanine or arginine disrupts progesterone binding, confirming its role in ligand interaction .

4.2. Role in Disease Models

  • Kidney Cancer: PAQR5 (human homolog) downregulation correlates with poor prognosis in renal carcinoma, suggesting conserved roles in tissue homeostasis .

  • Reproductive Dysfunction: CRISPR/Cas9 knockout of pgrmc1 in zebrafish reduces paqr5a expression and impairs oocyte maturation .

Future Directions and Research Gaps

  • Structural Resolution: Full crystallographic data are needed to validate homology models of paqr5a .

  • In Vivo Signaling Pathways: The interplay between paqr5a, PGRMC1, and nuclear progesterone receptors remains unclear .

  • Therapeutic Potential: Targeting paqr5a could address progesterone-related disorders in reproduction or cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
paqr5a; mprg; paqr5; zgc:56016; Membrane progestin receptor gamma-A; mPR gamma-A; Progestin and adipoQ receptor family member V-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
paqr5a
Target Protein Sequence
MLNLIKLPQVFTINQVPKVFHEDGIISGYRHPCSSAKDCVLSLFQLTNETLNIWTHFLPT WFFLWKLLTVVLVLEDWRDPFIWPFLVFLLSCCVYPLASSCAHTFSTMSERARHICFFFD YGALSFYSLGSAIIYSSYSFPDKWVNGTFHLNYVSIAVVNSIISTALACYSRLGLPFLEY NCHSIKRPSGKLDQKLCKCLRIIAFVYPYLFDNIPLFYRIFVCAGEGCTVNEANTVHYQH TSLAFFTGFLFATHLPERLAPGSFDYIGHSHQLFHVFAIIGTYFQMTAIELDMAARKQWL HAHLPPVTFLNTVGAAFFSVVSGLCIVYVFSLSLFSTRGVKNKSF
Uniprot No.

Target Background

Function

Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation.

Database Links
Protein Families
ADIPOR family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Paqr5a and how does it function in zebrafish biology?

Paqr5a (Membrane progestin receptor gamma-A) is a member of the progestin and adipoQ receptor family in zebrafish (Danio rerio). It functions as a membrane-bound receptor for progestins and plays a role in reproductive biology, specifically in oocyte development. Unlike nuclear steroid receptors, Paqr5a belongs to a class of membrane progestin receptors that mediate rapid, non-genomic responses to progestins. The protein spans the cell membrane with multiple transmembrane domains and contains a characteristic seven-transmembrane structure typical of G protein-coupled receptors . Its function appears to be related to steroid hormone signaling pathways, particularly those involved in oocyte maturation and reproduction in zebrafish .

How does Paqr5a expression vary across zebrafish developmental stages?

The expression of Paqr5a varies throughout zebrafish development, with specific patterns occurring in reproductive tissues. While detailed temporal expression data specifically for Paqr5a is limited in the provided sources, research methodologies such as whole mount in situ hybridization (ISH) can be employed to visualize Paqr5a expression patterns through embryonic and larval development stages. This technique is particularly valuable as it overcomes penetration and detection problems in later developmental stages, allowing visualization of gene expression patterns up to the late larval stage in a three-dimensional manner without tissue sectioning . Quantitative PCR (qPCR) analysis has shown that Paqr5a is expressed in zebrafish ovarian tissues, though at levels that may be below detection limits in some stages .

What is the relationship between Paqr5a and other membrane progestin receptors in zebrafish?

Zebrafish possess multiple membrane progestin receptors, including mPRα, mPRβ (Paqr8), mPRγ1 (Paqr5a), mPRγ2 (Paqr5b), mPRδ (Paqr6), and mPRε (Paqr9). These receptors form a family of related proteins with distinct expression patterns and potentially specialized functions. Research has shown that while mPRα plays a critical role in oocyte maturation, other family members including Paqr5a may have complementary or compensatory roles. Studies examining Pgrmc1 knockout zebrafish found no significant difference in expression of Paqr5a in Stage IVa follicles between wildtype and knockout animals, suggesting independent regulation from Pgrmc1 . Unlike mPRα, which is extensively studied for its role in mediating progestin-induced oocyte maturation, the specific physiological functions of Paqr5a in zebrafish reproduction are less comprehensively documented in the current literature.

What are the most effective methods for detecting Paqr5a expression in zebrafish tissues?

For detecting Paqr5a expression in zebrafish tissues, researchers should consider multiple complementary approaches:

  • Whole mount in situ hybridization (ISH): This modified method allows detection and visualization of gene expression patterns up to late larval stages in a three-dimensional manner. It overcomes penetration and detection problems in dense tissues without requiring sectioning, making it ideal for developmental expression studies of Paqr5a .

  • Quantitative PCR (qPCR): This technique provides quantitative measurement of Paqr5a transcript levels. When designing qPCR experiments for Paqr5a, researchers should note that expression levels may be below detection limits in some stages or tissues, requiring at least 45 PCR cycles for reliable detection, as observed in studies of zebrafish ovarian tissues .

  • Western blotting: Using antibodies specific to Paqr5a protein, this technique can detect protein expression levels in tissue extracts. This approach complements transcript-level analyses and can reveal post-transcriptional regulation.

  • Immunohistochemistry/Immunofluorescence: These techniques can visualize the cellular and subcellular localization of Paqr5a protein in tissue sections, providing spatial information about expression patterns.

These methods should be used in combination to gain comprehensive understanding of both the transcript and protein expression patterns of Paqr5a across different tissues and developmental stages.

What are the technical challenges in producing functional recombinant Paqr5a protein?

Producing functional recombinant Paqr5a protein presents several technical challenges that researchers should address:

  • Expression system selection: While E. coli has been successfully used for recombinant Paqr5a expression , this prokaryotic system lacks post-translational modification capabilities that might be essential for full functionality. Alternative expression systems such as insect cells or mammalian cells might produce more natively folded protein.

  • Membrane protein solubilization: As a seven-transmembrane protein, Paqr5a requires careful solubilization and purification protocols. Detergent selection is critical, as inappropriate detergents may denature the protein or disrupt its native conformation.

  • Protein folding and stability: Ensuring proper folding of multiple transmembrane domains is challenging. Addition of stabilizing agents such as glycerol (recommended at 5-50% final concentration) helps maintain protein stability during storage .

  • Tag position and interference: His-tags used for purification (as in commercially available recombinant Paqr5a) may interfere with protein function if positioned near functional domains. Careful design and validation of tagged constructs is essential.

  • Functional validation: Confirming that recombinant Paqr5a retains proper binding and signaling capabilities requires specialized assays, including progestin binding assays similar to those performed for other membrane progestin receptors .

How can researchers establish an effective in vitro system to study Paqr5a function?

An effective in vitro system for studying Paqr5a function should include these key components:

  • Cell model selection: Cells lacking endogenous progestin receptors (such as PR-negative breast cancer cell lines used in mPR studies) provide clean backgrounds for functional studies . Alternatively, zebrafish cell lines or primary cultures of zebrafish oocytes or follicle cells offer more physiologically relevant contexts.

  • Expression construct design: For optimal expression, researchers should consider codon optimization for the host cell system and include epitope tags that allow detection without compromising function. Based on approaches used for related receptors, an N-terminal tag is preferable to C-terminal tagging, which may disrupt signaling .

  • Functional readouts: Multiple assays should be established to measure:

    • Progestin binding (using tritiated progesterone or fluorescent progestin analogs)

    • G-protein activation (using [35S]GTPγS binding assays)

    • Downstream signaling events (cAMP measurements, calcium mobilization, or MAPK activation)

    • Physiological endpoints relevant to oocyte maturation (such as germinal vesicle breakdown)

  • Validation controls: Include parallel experiments with well-characterized membrane progestin receptors such as mPRα as positive controls, and use mPR-specific agonists like Org OD 02-0 to distinguish from classical nuclear progesterone receptor activity .

  • Interaction studies: Co-immunoprecipitation or proximity ligation assays should be considered to identify potential interaction partners, as demonstrated for the related protein mPRα with adaptor proteins like Pgrmc1 .

How does Paqr5a signaling differ from nuclear progestin receptor signaling in zebrafish?

Paqr5a signaling fundamentally differs from nuclear progestin receptor signaling in several key aspects:

  • Localization and mechanism: As a membrane progestin receptor, Paqr5a localizes to the cell membrane and mediates rapid, non-genomic responses to progestins. In contrast, nuclear progestin receptors act primarily as ligand-activated transcription factors that translocate to the nucleus upon hormone binding and regulate gene expression .

  • Signaling cascade: Paqr5a likely signals through G-protein-coupled mechanisms similar to other membrane progestin receptors. Evidence from studies on related receptors like mPRα indicates activation of inhibitory G-proteins upon progestin binding, leading to decreased intracellular cAMP levels and activation of MAPK signaling pathways. Nuclear receptors, conversely, form transcriptional complexes with coactivators and corepressors to modulate gene expression .

  • Temporal dynamics: Paqr5a-mediated responses occur rapidly (seconds to minutes) compared to the slower (hours) transcriptional responses mediated by nuclear receptors. This rapid signaling is particularly important in processes like oocyte maturation where quick responses to hormonal changes are essential .

  • Ligand specificity: While both receptor types bind progestins, their binding affinities and specificities differ. Membrane progestin receptors show high affinity for progestins like 17α,20β-dihydroxy-4-pregnen-3-one (DHP), which is particularly important in fish oocyte maturation .

What is the relationship between Paqr5a and Pgrmc1 in zebrafish reproduction?

The relationship between Paqr5a and Pgrmc1 in zebrafish reproduction represents a complex interplay between different components of progestin signaling:

  • Expression regulation: Studies of Pgrmc1 knockout zebrafish found no significant difference in Paqr5a (mPRγ1) expression levels in Stage IVa follicles between knockout and wildtype animals. This suggests that, unlike mPRα whose expression is influenced by Pgrmc1, Paqr5a expression is regulated independently of Pgrmc1 .

  • Functional relationship: Pgrmc1 functions as an adaptor protein that facilitates membrane localization of certain membrane progestin receptors, particularly mPRα. While the direct relationship between Pgrmc1 and Paqr5a has not been explicitly characterized in the available literature, the lack of expression changes in Pgrmc1 knockout animals suggests their functional pathways may be distinct or complementary rather than directly linked .

  • Oocyte maturation context: In zebrafish reproduction, Pgrmc1 plays a significant role in oocyte maturation by regulating the membrane localization and function of mPRα. When Pgrmc1 is knocked out, oocyte maturation is impaired despite compensatory upregulation of mPRα transcripts, due to reduced membrane expression of functional mPRα protein . The specific contribution of Paqr5a to this process appears to be secondary based on current evidence.

  • Potential functional redundancy: The maintained expression of Paqr5a in Pgrmc1 knockout zebrafish may suggest a potential compensatory role for this receptor in the absence of fully functional mPRα signaling, though this hypothesis requires further investigation .

What is the theoretical model for how Paqr5a coordinates with other membrane progestin receptors during oocyte maturation?

Based on the available research, a theoretical model for Paqr5a coordination with other membrane progestin receptors during oocyte maturation can be proposed:

  • Complementary expression patterns: Different membrane progestin receptors, including Paqr5a, may be expressed at different stages of oocyte development or in different cell types within the follicular complex. This creates a spatiotemporal coordination of progestin responsiveness throughout oocyte maturation .

  • Signal integration: Paqr5a likely participates in an integrated signaling network where multiple membrane progestin receptors detect progestin hormones and activate potentially overlapping but distinct downstream pathways. The predominant receptor appears to be mPRα, which shows a clear role in mediating progestin-induced oocyte maturation through G-protein coupled signaling .

  • Differential regulation by adaptor proteins: Unlike mPRα, whose membrane localization and function are strongly regulated by Pgrmc1, Paqr5a appears to be regulated independently. This suggests that different membrane progestin receptors may utilize distinct trafficking and regulatory mechanisms to reach the cell surface and become functional .

  • Ligand sensitivity tuning: The presence of multiple membrane progestin receptors with potentially different binding affinities for progestins may allow for fine-tuned responses across a range of hormone concentrations. Paqr5a might respond to different concentrations of progestins than mPRα, contributing to the precise hormonal control of oocyte maturation .

  • Compensatory mechanisms: In situations where the function of one membrane progestin receptor is compromised (as seen with mPRα in Pgrmc1 knockout zebrafish), other family members including Paqr5a may potentially compensate, though with different efficacy or downstream consequences, explaining the delayed rather than completely blocked oocyte maturation in these models .

How can CRISPR/Cas9 genome editing be optimized for studying Paqr5a function in zebrafish?

Optimizing CRISPR/Cas9 genome editing for studying Paqr5a function in zebrafish requires careful consideration of several factors:

  • Guide RNA design strategy:

    • Target early exons to ensure functional disruption of the protein

    • Design multiple gRNAs targeting different regions of the Paqr5a gene to increase knockout efficiency

    • Use gRNA design tools that account for zebrafish genome-specific parameters to minimize off-target effects

    • Consider targeting highly conserved functional domains, such as transmembrane regions or the progestin binding domain

  • Functional domain targeting:

    • Based on the amino acid sequence of Paqr5a (1-345aa) , identify functional domains for targeted modification

    • Consider creating specific point mutations in putative signaling residues rather than complete gene knockout to study structure-function relationships

  • Phenotypic validation approaches:

    • Employ the whole mount in situ hybridization technique described for zebrafish larvae to confirm altered expression patterns

    • Utilize progestin binding assays similar to those performed for Pgrmc1 studies to assess functional consequences of Paqr5a modification

    • Examine oocyte maturation rates and responses to progestins (particularly DHP) in vitro and in vivo

  • Potential compensatory mechanisms:

    • Design experiments to address potential functional redundancy with other membrane progestin receptors

    • Consider creating double or triple knockouts with related receptors if single Paqr5a knockout shows limited phenotypes

    • Analyze expression levels of other membrane progestin receptors (mPRα, mPRβ, mPRγ2, etc.) in Paqr5a mutants to identify compensatory upregulation

  • Temporal control considerations:

    • Implement inducible CRISPR systems to bypass early developmental requirements and study stage-specific functions

    • Use tissue-specific promoters to drive Cas9 expression for targeted knockout in reproductive tissues

What approaches can resolve contradictory data regarding Paqr5a function in different experimental models?

Resolving contradictory data regarding Paqr5a function requires systematic investigation using multiple complementary approaches:

  • Standardization of experimental conditions:

    • Establish consistent protocols for recombinant protein production, ensuring proper folding and functionality of Paqr5a

    • Standardize hormone concentrations and preparation methods across studies

    • Control for differences in cellular contexts that might affect receptor functionality

  • Multi-level analysis:

    • Integrate data from transcript expression (qPCR), protein expression (Western blot), localization (immunocytochemistry), and functional studies (binding assays, signaling assays)

    • Compare results across different model systems (cell lines, primary cultures, in vivo models)

    • Examine both gain-of-function (overexpression) and loss-of-function (knockout/knockdown) approaches

  • Resolution of transcript-protein discrepancies:

    • Investigate post-transcriptional regulation mechanisms, as seen in the case of mPRα in Pgrmc1 knockout zebrafish, where increased transcripts did not result in increased protein expression

    • Examine protein stability and degradation rates using pulse-chase experiments

    • Assess trafficking efficiency to the plasma membrane, where the receptor is functional

  • Interaction mapping:

    • Perform systematic interaction studies to identify proteins that associate with Paqr5a

    • Use proximity ligation assays as employed for mPRα and Pgrmc1 to verify protein-protein interactions in situ

    • Investigate whether interactions with adaptor proteins like Pgrmc1 differ across experimental models

  • Consideration of species-specific differences:

    • Compare Paqr5a function across species to identify conserved versus species-specific aspects

    • Account for differences in reproductive physiology when extrapolating findings between species

How might Paqr5a signaling interact with other reproductive hormone pathways in zebrafish?

The interaction between Paqr5a signaling and other reproductive hormone pathways in zebrafish likely involves complex cross-talk mechanisms:

  • Estrogen pathway integration:

    • Investigate potential interaction between Paqr5a and estrogen signaling components, particularly in light of findings that Pgrmc1 is involved in estrogen maintenance of oocyte meiotic arrest via G protein-coupled estrogen receptor 1 (Gper) signaling

    • Examine whether Paqr5a expression or function is regulated by estrogens or estrogen receptors

    • Explore potential direct interactions between Paqr5a and estrogen receptors, similar to the interaction observed between Pgrmc1 and estrogen receptor β

  • Growth factor signaling cross-talk:

    • Study potential interactions between Paqr5a and growth factor signaling pathways, particularly the epidermal growth factor receptor (Egfr) pathway implicated in oocyte maturation

    • Determine whether Paqr5a influences Egfr expression or membrane localization, as has been observed with Pgrmc1

    • Investigate shared downstream signaling components between Paqr5a and growth factor pathways

  • Gonadotropin signaling integration:

    • Examine how gonadotropin (FSH, LH) signaling affects Paqr5a expression and function

    • Research suggests progestin induction of oocyte maturation depends on gonadotropin-mediated increases in membrane expression of mPRα; determine whether similar regulation applies to Paqr5a

    • Map the temporal relationship between gonadotropin surges and changes in Paqr5a expression or activity

  • Cell cycle regulation:

    • Investigate how Paqr5a signaling interfaces with cell cycle regulators critical for oocyte maturation

    • Explore potential associations between Paqr5a and kinases involved in meiotic progression (such as Aurora kinase B, which associates with Pgrmc1)

    • Determine whether Paqr5a influences maturation promoting factor (MPF) activity, a critical regulator of oocyte maturation

  • Membrane receptor complexes:

    • Characterize potential formation of heteromeric complexes between Paqr5a and other membrane receptors

    • Investigate whether Paqr5a functions independently or as part of larger signaling complexes

    • Examine how membrane domain organization (lipid rafts, etc.) affects integration of Paqr5a with other signaling pathways

What are the critical parameters for storage and reconstitution of recombinant Paqr5a protein?

The critical parameters for storage and reconstitution of recombinant Paqr5a protein include:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% recommended) and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow protein to fully dissolve by gentle agitation rather than vortexing

  • For membrane proteins like Paqr5a, consider adding appropriate detergents to maintain solubility if required for downstream applications

Buffer considerations:

  • The recombinant Paqr5a is provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • This buffer composition helps maintain protein stability during storage

  • For functional studies, buffer exchange may be necessary depending on the specific application

Quality control checks:

  • Verify protein purity via SDS-PAGE (should be >90%)

  • Confirm protein identity via Western blot with anti-His antibodies or Paqr5a-specific antibodies

  • For functional studies, verify activity through appropriate binding assays

What experimental controls are essential when studying Paqr5a function in zebrafish models?

When studying Paqr5a function in zebrafish models, the following experimental controls are essential:

  • Genetic controls:

    • Use appropriate wildtype lines matched to the genetic background of mutant or transgenic lines

    • For CRISPR/Cas9 experiments, include both non-injected controls and controls injected with non-targeting gRNAs

    • For morpholino studies, include standard control morpholinos and rescue experiments with Paqr5a mRNA to confirm specificity

  • Expression validation controls:

    • Confirm knockout or knockdown efficiency at both mRNA level (via qPCR) and protein level (via Western blot)

    • For overexpression studies, verify protein expression and proper membrane localization

    • Use whole mount in situ hybridization to confirm spatial expression patterns

  • Functional controls:

    • Include positive controls using well-characterized membrane progestin receptors (e.g., mPRα)

    • Use both receptor-specific agonists and antagonists to confirm specificity of observed effects

    • For progestin stimulation experiments, include vehicle controls and dose-response analyses

    • When studying oocyte maturation, use established positive controls such as DHP (17α,20β-dihydroxy-4-pregnen-3-one)

  • Pathway controls:

    • Confirm G-protein coupling by measuring G-protein activation in response to ligand binding

    • Include inhibitors of downstream signaling pathways to confirm mechanism of action

    • For interaction studies with proteins like Pgrmc1, include appropriate co-immunoprecipitation controls

  • Developmental and physiological controls:

    • Control for stage-specific effects by careful staging of embryos and oocytes

    • Account for natural variation in oocyte maturation by using sufficient biological replicates

    • Include time-course analyses to distinguish direct from indirect effects

What are the critical quality control parameters for validating recombinant Paqr5a protein activity?

Validating recombinant Paqr5a protein activity requires assessment of multiple quality control parameters:

  • Structural integrity validation:

    • Assess protein folding through circular dichroism spectroscopy, particularly important for multi-transmembrane proteins

    • Verify size and purity through SDS-PAGE (>90% purity expected) and size exclusion chromatography

    • Confirm protein identity through mass spectrometry analysis of tryptic peptides

    • Examine secondary structure elements critical for membrane insertion and function

  • Ligand binding capability:

    • Perform progestin binding assays using tritiated progesterone or fluorescently labeled progestins

    • Determine binding affinity (Kd) and compare with published values for related receptors

    • Assess binding specificity using competition assays with various steroids

    • For membrane progestin receptors, binding assays should demonstrate specificity for progestins over other steroids, with Kd values in the nanomolar range (similar to the 4.7 nM value reported for mPRα)

  • Functional signaling activation:

    • Measure G-protein activation using [35S]GTPγS binding assays following progestin stimulation

    • Assess downstream signaling effects such as changes in cAMP levels or MAPK activation

    • Verify signaling specificity using receptor-specific agonists like Org OD 02-0

    • Confirm that signaling responses occur with dose-dependency and appropriate kinetics

  • Membrane incorporation:

    • Verify successful incorporation into artificial membranes or liposomes for in vitro studies

    • Confirm proper trafficking to the plasma membrane in cell expression systems

    • Assess receptor orientation in membranes to ensure the ligand-binding domain is accessible

    • Examine membrane microdomain localization, which may be critical for function

  • Protein-protein interactions:

    • Validate ability to form expected complexes with interaction partners

    • Confirm that tagged recombinant protein maintains normal interaction capabilities

    • Use techniques such as co-immunoprecipitation, FRET, or proximity ligation assays to verify interactions in cellular contexts

    • Investigate potential interactions with adaptor proteins like those documented for related receptors

How can zebrafish Paqr5a research contribute to understanding human reproductive disorders?

Zebrafish Paqr5a research can contribute to understanding human reproductive disorders through several translational pathways:

  • Conserved signaling mechanisms: Membrane progestin receptors including Paqr5a homologs are present in humans and show similar signaling characteristics to those in zebrafish. Understanding the fundamental mechanisms of Paqr5a function in zebrafish can illuminate the roles of these receptors in human reproduction . The conservation of progesterone signaling components between species makes zebrafish a valuable model for investigating basic mechanisms that may be relevant to human fertility disorders.

  • Model for oocyte maturation defects: Disorders of oocyte maturation in humans can lead to infertility or poor oocyte quality. Zebrafish Paqr5a research can provide insights into non-genomic progesterone signaling mechanisms involved in oocyte maturation, potentially revealing new therapeutic targets for human fertility treatments . The relatively simple genetic manipulation of zebrafish allows for creation of models that would be difficult to study in humans or other mammals.

  • Compound screening platform: Zebrafish provide an efficient vertebrate model for screening compounds that affect reproductive function through membrane progestin receptors. Such screens could identify novel therapeutics for reproductive disorders characterized by abnormal progesterone signaling. The ability to perform high-throughput studies in zebrafish makes this particularly valuable for early-stage drug discovery.

  • Insights into steroid hormone resistance: Understanding how Paqr5a functions and is regulated can shed light on mechanisms of hormone resistance in reproductive disorders. By elucidating the interaction between Paqr5a and adaptor proteins like Pgrmc1, researchers can better understand how defects in receptor trafficking or signaling contribute to reproductive dysfunction .

  • Environmental endocrine disruptor effects: Zebrafish Paqr5a models can be used to study how environmental contaminants affect non-genomic progestin signaling, potentially explaining some mechanisms of endocrine disruption relevant to human reproductive health. The external fertilization and development of zebrafish make them particularly useful for such studies.

What are the most promising experimental approaches for resolving the specific function of Paqr5a in zebrafish reproduction?

The most promising experimental approaches for resolving Paqr5a function in zebrafish reproduction include:

  • Tissue-specific and inducible knockout models: Development of conditional Paqr5a knockout zebrafish using Cre-lox or similar systems would allow temporal and spatial control over gene disruption, helping to overcome potential developmental lethality and distinguish primary from secondary effects. This approach could specifically target Paqr5a deletion in ovarian tissues at defined developmental stages.

  • Single-cell transcriptomics: Applying single-cell RNA sequencing to zebrafish ovarian follicles at different stages of development would reveal the precise cellular expression patterns of Paqr5a and co-expressed genes, potentially identifying functional networks and compensatory mechanisms. This would provide a more nuanced understanding than conventional qPCR approaches that may miss cell-type-specific expression patterns .

  • Super-resolution imaging of protein complexes: Utilizing techniques such as STORM or PALM microscopy combined with proximity ligation assays would allow visualization of Paqr5a interactions with other membrane proteins at nanoscale resolution, revealing how receptor complexes form and function at the cell membrane. This approach has been valuable for related receptors like mPRα .

  • Domain-specific mutations: Rather than complete knockout, creating zebrafish lines with specific mutations in functional domains of Paqr5a would help dissect structure-function relationships. This could include mutations in ligand binding domains, G-protein coupling regions, or interaction sites with adaptor proteins.

  • Reconstituted systems with purified components: Developing in vitro systems with purified recombinant Paqr5a incorporated into artificial membranes, along with putative signaling partners, would allow detailed biochemical and biophysical studies of receptor function under controlled conditions. This approach could definitively establish direct interactions and signaling mechanisms.

  • Receptor trafficking studies: Using fluorescently tagged Paqr5a in combination with live cell imaging would reveal dynamic aspects of receptor trafficking, endocytosis, and recycling in response to hormonal stimulation. This could illuminate how receptor availability at the cell surface is regulated during different phases of oocyte maturation.

What are the potential applications of recombinant Paqr5a protein beyond basic research?

Recombinant Paqr5a protein has several potential applications beyond basic research:

  • Antibody development and validation: Purified recombinant Paqr5a serves as an essential antigen for generating specific antibodies needed for detection and localization studies. High-quality antibodies are crucial research tools but are currently limited for many membrane progestin receptors. The availability of well-characterized recombinant protein enables development of validated immunological reagents .

  • High-throughput screening platforms: Immobilized recombinant Paqr5a can be used in binding assays to screen compound libraries for novel ligands, antagonists, or allosteric modulators. Such screens could identify compounds with potential applications in reproductive medicine or environmental monitoring. The well-defined properties of the recombinant protein (amino acid sequence 1-345, His-tag, etc.) make it suitable for standardized screening platforms .

  • Structural biology studies: Although challenging for multi-pass membrane proteins, recombinant Paqr5a could be used for structural determination via X-ray crystallography, cryo-EM, or NMR spectroscopy. Structural insights would significantly advance understanding of ligand binding mechanisms and potentially guide rational drug design targeting membrane progestin receptors.

  • Biomarker development: Understanding Paqr5a and its signaling could lead to development of biomarkers for reproductive health assessment in fish and potentially other vertebrates. Such biomarkers could be valuable for environmental monitoring, aquaculture, and conservation efforts.

  • Biosensor development: Engineered versions of recombinant Paqr5a could be developed into biosensors for detecting progestins or endocrine-disrupting chemicals in environmental samples. Such applications would require stabilized protein formulations like those currently available (lyophilized powder, reconstituted in Tris/PBS-based buffer with 6% Trehalose) .

  • Educational tools: Well-characterized recombinant proteins like Paqr5a serve as valuable resources for teaching protein biochemistry, receptor pharmacology, and molecular biology techniques in educational settings. The defined properties and handling protocols make it suitable for standardized laboratory exercises .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.