Recombinant Danio rerio Mitochondrial fission process protein 1 (mtfp1)

Shipped with Ice Packs
In Stock

Description

Molecular Architecture

  • Localization: Mitochondrial inner membrane (IMM) .

  • Interactions: Binds adenine nucleotide translocase (ANT) and regulates mitochondrial permeability transition pore (mPTP) opening .

  • Orthology: Shares ~35% sequence identity with human MTFP1 (Q9UDX5) .

Functional Roles

ProcessZebrafish mtfp1 InvolvementKey Findings
Mitochondrial FissionPredicted role in IMM division Dispensable for fission in cardiomyocytes; affects OXPHOS efficiency .
Apoptosis RegulationModulates cytochrome c release and caspase activation Loss-of-function triggers apoptosis .
Metabolic RegulationLinked to oxidative phosphorylation (OXPHOS) and lipid metabolism Ablation enhances OXPHOS in hepatocytes, protecting against steatosis .

Recombinant Expression

  • Host Systems: Typically expressed in E. coli or mammalian cells (e.g., HEK293) .

  • Tags: GST or His-tags for purification .

  • Construct Design: Often fused to fluorescent proteins (e.g., mCherry, YPet) or trafficking proteins (e.g., Rab5c) .

Key Constructs

ConstructPurposeLocalizationApplication
mTFP1-Rab5c (zebrafish)Tracking early endosome dynamics via DARPins Plasma membrane/cytoplasmRelocalization experiments to study Rab5c function.
Mito-mTFP1Mitochondrial targeting via MitoNEET tag Outer mitochondrial membraneBinding assays with anti-mTFP1 DARPins.

DARPins for Functional Studies

Anti-mTFP1 DARPins (e.g., 1238_E11, 1238_G01) enable precise binding and relocalization:

DARPinAffinity (KD)ApplicationOutcome
1238_E113 nM Mitochondrial surface binding via mTFP1 baitCo-localization confirmed via confocal imaging .
1238_G016 nM Plasma membrane tethering via CAAX motifRelocalizes mTFP1-Rab5c to the plasma membrane .

Key Findings:

  • DARPins enable in vivo manipulation of mTFP1 fusion proteins, enabling studies on mitochondrial dynamics and organelle trafficking .

  • Zebrafish mTFP1 serves as a scaffold for studying mitochondrial protein interactions in developmental models .

Metabolic and Disease Models

Table 2: DARPins for mTFP1 Binding

DARPinAffinity (KD)TagFunctionality
1238_E113 nMmCherryMitochondrial surface binding
1238_G016 nMYPet-CAAXPlasma membrane relocalization

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
mtfp1; mtp18; zgc:63910; Mitochondrial fission process protein 1; Mitochondrial 18 kDa protein; MTP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
mtfp1
Target Protein Sequence
MEPSADTHSKPVDIYRDTWVRFLGYANEVGEAFRALVPVGAVWASYGVATTYVTADAIDK GRKAAAAHGERPGKAVCVCVAVVDTFVWQALASVAVPGFTINRVCAASHFLLSRTTRWPL PVRKWTTTAIGLSTIPFIITPIDRSVDLLLDSSLRKLYSEGEKED
Uniprot No.

Target Background

Function

This protein is involved in mitochondrial division, likely by regulating membrane fission. Loss-of-function is associated with apoptosis.

Database Links

KEGG: dre:393659

UniGene: Dr.16634

Protein Families
MTFP1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the known isoforms of MTF-1 in zebrafish and how do they differ structurally?

Zebrafish possess multiple MTF-1 isoforms that differ in their structural composition. The complete MTF-1 contains the highly conserved cysteine-rich motif (Cys-X-Cys-Cys-X-Cys) found in all other vertebrate MTF-1 orthologues, while a previously identified shorter isoform lacks this motif . This structural difference is significant because the cysteine-rich domain plays an important role in the protein's response to metal ions and cellular stress. Researchers should be aware that while the complete MTF-1 transcripts have been described in other fish species, zebrafish was initially thought to only possess the shorter variant . This structural diversity may influence experimental outcomes when studying MTF-1 function in zebrafish compared to other vertebrate models.

What is the primary function of MTF-1 in zebrafish embryonic development?

MTF-1 in zebrafish responds to changes in cellular zinc levels caused by zinc exposure or disruption of endogenous zinc homeostasis by heavy metals or oxygen-related stress . During embryonic development, MTF-1 signaling affects multiple developmental processes including stress signaling, neurogenesis, muscle development and contraction, eye development, and metal homeostasis . Transcriptomic profiling of zebrafish embryos with inhibited MTF-1 signaling revealed significant changes in gene expression at 28 hours post-fertilization (hpf) and 36 hpf, with 594 and 560 differentially expressed probes respectively . Notably, MTF-1 appears to function both as a transcriptional activator and a transcriptional repressor of potential novel target genes identified during early zebrafish development .

How can researchers effectively inhibit endogenous MTF-1 signaling in zebrafish embryos?

Researchers can effectively inhibit endogenous MTF-1 signaling in zebrafish embryos using a constitutively nuclear dominant-negative MTF-1 (dnMTF-1). This approach involves microinjecting in vitro transcribed dnMTF-1 mRNA into zebrafish embryos at the 1-2 cell stage . The efficacy of this inhibition can be assessed through transcriptomic profiling, which has been successfully performed using Agilent 4 × 44K arrays on 28- and 36-hpf embryos . While antisense morpholinos (MO) have been popular for gene function studies in zebrafish embryos, they have limitations due to transient effects from dilution during development, making them less feasible for studies using older larvae, juveniles or adults . The dominant-negative approach offers an alternative that could potentially be adapted for transgenic applications, similar to the successful use of a dominant-negative bone morphogenetic protein (Bmp) under control of a heat shock-inducible promoter .

What methodologies can be used to characterize the binding affinity and specificity of protein binders like DARPins to fluorescent proteins in zebrafish?

To characterize binding affinity and specificity of protein binders like DARPins to fluorescent proteins such as mTFP1, researchers can employ multiple complementary techniques. Initial screening can be conducted using titration ELISAs against the target protein (e.g., mTFP1) and other fluorophores (e.g., GFP and mCherry) as well as unrelated proteins to assess specificity . For precise affinity measurements, fluorescence anisotropy can be used to determine equilibrium dissociation constant (KD) values, with studies showing values of 3 nM for DARPin 1238_E11 and approximately 88 nM for DARPin 1238_G01 when binding to mTFP1 . Competition/epitope blocking ELISAs help determine whether different binders recognize non-overlapping epitopes on the target protein . Structural characterization through X-ray crystallography provides detailed information about the binding interface, as demonstrated by the crystal structures of DARPin 1238_E11 in complex with mTFP1 resolved at 1.83 Å (P212121) and 1.85 Å (C2) resolution .

How can researchers assess the in vivo functionality of anti-mTFP1 DARPins in zebrafish cells?

Researchers can assess the in vivo functionality of anti-mTFP1 DARPins in zebrafish cells through several established approaches. First, expression and subcellular localization should be evaluated by fusing DARPins to different fluorescent proteins (such as mCherry or YPet) and using transient transfection in cellular systems . When expressed alone, properly folded DARPins should show uniform distribution in both cytoplasm and nucleus, as observed with anti-mTFP1 DARPins 1238_E11 and 1238_G01 . To test binding capability, researchers should co-express the DARPin-fluorescent protein fusions with mTFP1-tagged proteins localized to specific subcellular compartments, such as mitochondria-targeted mTFP1 . Successful binding is indicated by co-localization of the DARPin fusion protein with the mTFP1-tagged target at the specific subcellular location . Further functional validation can include relocalization experiments, where membrane-tethered DARPins (using CAAX motifs) or nuclear-localized DARPins can be used to recruit mTFP1-fusion proteins to these compartments, effectively altering their normal localization and function .

What approaches can be used to investigate both the transcriptional activator and repressor roles of MTF-1 in zebrafish?

Investigation of MTF-1's dual roles as transcriptional activator and repressor requires comprehensive experimental strategies in zebrafish. Transcriptomic profiling following inhibition of MTF-1 signaling with dominant-negative MTF-1 reveals genes both up- and down-regulated, providing initial candidates for direct or indirect regulation . For validating direct transcriptional activation, researchers can perform promoter analysis of affected genes to identify metal-responsive elements (MREs), followed by chromatin immunoprecipitation (ChIP) to confirm MTF-1 binding to these elements . To distinguish direct repression from indirect effects, reporter gene assays utilizing the promoters of putative target genes can be conducted in the presence of wild-type versus dominant-negative MTF-1 . Time-course experiments during zebrafish development help determine temporal aspects of MTF-1 regulation, as demonstrated by the differential expression patterns observed at 28 hpf versus 36 hpf embryos . Tissue-specific analyses of MTF-1 activity can further elucidate its context-dependent functions in different developmental processes, including neurogenesis, muscle development, eye development, and metal homeostasis pathways .

How can mTFP1-binding DARPins be utilized to study protein localization and function during zebrafish development?

mTFP1-binding DARPins offer powerful tools for studying protein localization and function during zebrafish development through several innovative approaches. These DARPins can be functionalized to deliberately relocalize mTFP1-tagged proteins to specific subcellular compartments, as demonstrated with the relocalization of mTFP1-Rab5c to the plasma membrane or nucleus using membrane-tethered or nuclear-localized DARPins respectively . For developmental studies, both endogenous copies of a gene of interest can be engineered using CRISPR/Cas9 technology to encode mTFP1-fusion proteins, allowing subsequent manipulation with anti-mTFP1 DARPins . Alternatively, a single rescue copy encoding an mTFP1-fusion protein can be introduced into a genetic null background of the corresponding gene . This approach enables acute loss-of-function phenotypes through protein depletion from functional compartments rather than genetic knockouts, potentially revealing different aspects of protein function . The advantage of using mTFP1 as a tag in multiparametric approaches is that other fluorescent proteins such as GFP or red fluorescent proteins can still be used as independent markers to monitor other cellular processes simultaneously .

What insights have been gained about metal homeostasis in zebrafish embryonic development through MTF-1 studies?

Studies of MTF-1 in zebrafish have revealed crucial insights into metal homeostasis during embryonic development. Inhibition of MTF-1 signaling through dominant-negative approaches has identified numerous genes involved in metal homeostasis that are regulated during early development, with particular impacts on zinc homeostasis pathways . Interestingly, novel observations regarding iron and heme homeostasis have also emerged from these studies, suggesting a broader role for MTF-1 in coordinating multiple metal regulatory networks beyond zinc . The temporal analysis at 28 hpf and 36 hpf demonstrates dynamic regulation of these pathways during critical developmental windows, with both overlapping and distinct gene expression changes between timepoints . Beyond metal homeostasis, MTF-1 signaling affects genes involved in stress response pathways, providing evidence for interconnected regulation between metal sensing and cellular stress mechanisms during development . The dual function of MTF-1 as both transcriptional activator and repressor likely contributes to the precise coordination of these complex developmental processes .

What are the advantages of using DARPins against fluorescent proteins compared to other protein binders in zebrafish research?

DARPins offer several advantages over other protein binders for zebrafish research applications. Their exceptional folding properties result in high solubility in the intracellular environment, with anti-mTFP1 DARPins showing well-distributed expression inside cells without aggregation, even when overexpressed or fused to different fluorescent proteins . They maintain specific binding to their targets in various subcellular compartments, with both high-affinity (KD of 3 nM) and moderate-affinity (KD of ~88 nM) binders functioning effectively in cellular contexts . DARPins can be readily functionalized through fusion to various domains for protein manipulation strategies, including relocalization, degradation, trapping, or enzymatic modification of target proteins . The small size of DARPins (approximately 18 kDa compared to ~150 kDa for antibodies) minimizes steric hindrance issues when studying protein interactions or functions . The ability to select DARPins against different fluorescent proteins (including mTFP1, GFP, and mCherry) enables multiparametric approaches for imaging and manipulation in developing zebrafish, particularly valuable for studying complex developmental processes where multiple proteins need to be visualized or manipulated simultaneously .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.