Recombinant Danio rerio Mitochondrial import inner membrane translocase subunit Tim23 (timm23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
timm23; Mitochondrial import inner membrane translocase subunit Tim23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
timm23
Target Protein Sequence
MDNSTPPPGGFKGGLGSIFGGGTPEYSNTELSGVPLTGMSPLSPYLNVDPRYLIQDTDEF ILPTGANKTRGRFELAFFTIGGCCITGAAFGTLNGLRMGLSETRDMPWSKPRNVQILNMV TRQGASWANTLGSVALLYSVFGVAIEKARGAEDDLNTVAAGTLTGMVFKSTGGLKGVARG GLIGLAMSGLYALYNNWDHLKGKSPSHY
Uniprot No.

Target Background

Function
An essential component of the TIM23 complex, this protein mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It plays a crucial role in early embryonic development.
Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Tim23 in mitochondrial protein import?

Tim23 forms the central channel of the TIM23 complex, which is responsible for importing essentially all matrix proteins and numerous inner membrane proteins. The protein creates a water-filled pore that facilitates the passage of presequence-containing proteins across the mitochondrial inner membrane . Tim23 exhibits cation selectivity, which is critical for recognizing and transporting positively charged presequence peptides, the targeting signals that direct proteins to the mitochondrial matrix . The channel's selectivity is not merely an electrophysiological characteristic but plays a direct physiological role in protein import function .

How is the Tim23 protein structurally organized?

Tim23 consists of multiple transmembrane domains that span the mitochondrial inner membrane and a domain that extends into the intermembrane space. The intermembrane space domain interacts with Tim50, another essential component of the TIM23 complex . This interaction is crucial for protein translocation function. The channel-forming transmembrane regions contain conserved amino acid residues that face the aqueous channel lumen and contribute to the selective properties of the channel . Recent structural studies have revealed that Tim23 adopts a back-to-back orientation with Tim17 in the functional complex, and this orientation is maintained during precursor protein engagement .

What experimental approaches can verify proper folding of recombinant Tim23?

For recombinant Tim23, proper folding can be verified through:

  • Circular dichroism spectroscopy to confirm secondary structure content

  • Assessment of protein-protein interactions with known binding partners like Tim50 using chemical cross-linking or surface plasmon resonance

  • Functional reconstitution into liposomes followed by electrophysiological measurements to confirm channel activity

  • Evaluation of cation selectivity, which is an intrinsic property of properly folded Tim23

What expression systems are most effective for recombinant Danio rerio Tim23?

When expressing recombinant Tim23, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effectiveMay require fusion tags; lower induction temperatures (16-20°C)
Insect cellsBetter folding of membrane proteinsMore complex system; higher cost
Cell-free systemsDirect incorporation into liposomesLower yield; requires optimization

For functional studies, purification should be performed under conditions that maintain native protein structure, typically using mild detergents and including stabilizing agents such as glycerol in buffers. Expression can be optimized by using codon-optimized constructs for the expression host and including appropriate fusion tags to aid in purification.

What purification strategies maintain Tim23 functionality?

Successful purification of functional Tim23 requires:

  • Use of mild detergents (such as digitonin or DDM) that preserve membrane protein structure

  • Inclusion of stabilizing agents in all buffers (10-15% glycerol, reducing agents)

  • Affinity chromatography using engineered tags (His, Strep)

  • Size exclusion chromatography to remove aggregates

  • Temperature control throughout purification (4°C)

The purification strategy should be designed to minimize exposure to harsh conditions that could disrupt the native conformation of Tim23. After purification, functional assays should be performed to confirm that the protein retains its native properties.

How can I reconstitute Tim23 into liposomes for functional studies?

Reconstitution of Tim23 into liposomes can be achieved through:

  • Preparation of liposomes with appropriate lipid composition (typically including cardiolipin)

  • Mixing detergent-solubilized Tim23 with preformed liposomes

  • Detergent removal via dialysis, Bio-Beads, or cyclodextrin

  • Verification of reconstitution by:

    • Freeze-fracture electron microscopy

    • Flotation assays in sucrose gradients

    • Protease protection assays

Successful reconstitution should yield proteoliposomes with Tim23 in the correct orientation, capable of conducting ions in electrophysiological measurements and interacting with presequence peptides.

How can electrophysiological methods be used to characterize Tim23 channel activity?

Electrophysiological characterization provides critical insights into Tim23 function through:

  • Planar lipid bilayer recordings:

    • Reconstitute purified Tim23 into liposomes

    • Fuse proteoliposomes with planar lipid bilayers

    • Record single-channel currents under varying voltage conditions

    • Measure cation selectivity by changing ion compositions in chambers

Key parameters to evaluate include channel conductance, ion selectivity (preference for cations over anions), voltage-dependent gating, and response to substrate peptides. Mutations that reduce Tim23's cation selectivity directly impact its ability to respond to presequence peptides and impair its physiological function in protein import .

What mutations in Tim23 specifically affect channel selectivity and protein import?

Targeted mutagenesis studies have identified conserved residues that contribute to Tim23 channel function:

  • Pore-lining residues affecting ion selectivity:

    • N150 in yeast Tim23 (and corresponding residues in other species) is crucial for cation selectivity

    • Mutation N150A specifically reduced selectivity while preserving other channel properties

  • Functional consequences of selectivity mutations:

    • Decreased substrate sensitivity

    • Reduced import efficiency for matrix-targeted proteins (approximately 32% decrease)

    • Growth defects, particularly at higher temperatures

    • Normal mitochondrial membrane potential despite import defects

These findings suggest that the selective properties of the Tim23 channel are directly linked to its ability to recognize and transport presequence-containing proteins, connecting biophysical properties with physiological function.

How does Tim23 interact with Tim50, and why is this interaction essential?

The interaction between Tim23 and Tim50 is critical for protein import function:

  • Interaction characteristics:

    • The intermembrane space domain of Tim23 interacts with a conserved domain of Tim50

    • This interaction can be reconstituted in vitro using purified components

    • Chemical cross-linking and surface plasmon resonance can be used to track this interaction

  • Functional importance:

    • Mutations that disrupt Tim23-Tim50 interaction destabilize the complex in vivo

    • Disruption leads to defective import of preproteins via the TIM23 complex

    • Cells with destabilized interaction exhibit growth defects, particularly at higher temperatures

  • Experimental approaches to study the interaction:

    • In vitro reconstitution with purified components

    • Site-directed mutagenesis to identify critical residues

    • Biophysical methods (SPR, ITC) to determine binding parameters

What controls are essential when studying Tim23 channel activity?

When conducting electrophysiological studies of Tim23, critical controls include:

  • Channel identity verification:

    • Characteristic conductance (typically 100-150 pS)

    • Cation selectivity (preference for positive ions)

    • Voltage-dependent gating behavior

    • Response to specific inhibitors or antibodies

  • Functional response verification:

    • Activation by presequence peptides

    • Modulation by known interaction partners (e.g., Tim50)

    • Comparison with characterized mutations (e.g., selectivity mutants)

  • Technical controls:

    • Empty liposome preparations to rule out background conductances

    • Negative controls with heat-denatured protein

    • Multiple independent protein preparations to ensure reproducibility

These controls ensure that the observed channel activity genuinely represents Tim23 function and provides a foundation for interpreting experimental results.

How should researchers interpret contradictory results in Tim23 functional studies?

When faced with contradictory results, consider:

  • Experimental context differences:

    • In vitro vs. in organello vs. in vivo approaches may yield different outcomes

    • Reconstitution systems may lack regulatory components present in intact mitochondria

  • Protein preparation factors:

    • Detergent effects on protein conformation

    • Lipid composition in reconstitution experiments

    • Protein modifications or degradation during preparation

  • Methodological considerations:

    • Resolution and sensitivity limitations of different techniques

    • Time-scale differences between methods (capturing transient vs. stable states)

The research in demonstrates the value of combining in vitro single-channel results with in vivo and in organello experiments to build a comprehensive understanding of Tim23 function. This integrated approach revealed that mutations affecting channel selectivity directly impact physiological protein import.

What are the challenges in studying the dynamic behavior of Tim23 during protein translocation?

Investigating Tim23 dynamics during active translocation presents several challenges:

  • Technical limitations:

    • Capturing transient states during protein movement

    • Maintaining activity in experimental systems

    • Resolving structural changes at sufficient resolution

  • Complex interactions:

    • Tim23 functions within a multiprotein complex

    • Dynamic association with other components during translocation

    • Conformational changes upon substrate engagement

  • Methodological approaches to overcome these challenges:

    • Site-specific crosslinking with arrested translocation intermediates

    • FRET-based approaches to monitor distance changes

    • Time-resolved structural methods (e.g., cryo-EM of different states)

    • Hydrogen-deuterium exchange mass spectrometry

Recent research has shown that the TIM23 complex maintains its structural organization when engaged with precursor proteins, suggesting that the basic channel architecture remains stable during translocation .

How does Tim23 knockdown affect mitochondrial protein import in vivo?

Studies of Tim23 knockdown provide insights into its importance for mitochondrial function:

  • Direct effects on protein import:

    • Approximately 40% reduction in Tim23 protein content results in a 32% decrease in matrix-destined protein import

    • This demonstrates a proportional relationship between Tim23 levels and import capacity

  • Mitochondrial consequences:

    • Tendency toward elevated reactive oxygen species emission under maximal respiration conditions

    • Potential activation of compensatory mechanisms or stress responses

  • Experimental considerations:

    • Partial knockdown may reveal different phenotypes than complete deletion

    • Tissue-specific effects may be observed in different cell types

    • Time-dependent adaptation may occur in response to sustained Tim23 reduction

These findings highlight the central role of Tim23 in maintaining efficient mitochondrial protein import and suggest potential connections between import efficiency and mitochondrial stress responses.

What is the relationship between Tim23 and Tim17 in the functional TIM23 complex?

Recent structural studies have revealed important insights about Tim23-Tim17 organization:

These findings provide a structural foundation for understanding how the TIM23 complex coordinates protein translocation across or into the inner membrane.

How might Tim23 function be regulated under different cellular conditions?

Evidence suggests several potential regulatory mechanisms for Tim23 function:

  • Post-translational modifications:

    • Phosphorylation or other modifications may alter channel properties or interactions

    • These could provide responsive regulation based on cellular energy status

  • Protein-protein interactions:

    • Dynamic association with regulatory components

    • Interaction with different motor proteins (PAM complex) for matrix translocation

  • Feedback regulation:

    • Research suggests that mitochondrial proteolytic byproducts may exert inhibitory effects on protein import, possibly as a feedback mechanism to prevent excessive import

    • This represents a potential quality control mechanism connecting protein degradation with import regulation

  • Environmental responses:

    • Adaptation to stress conditions

    • Developmental regulation during different growth phases

Further research into these regulatory mechanisms may reveal how mitochondrial protein import is integrated with broader cellular processes and responds to changing cellular demands.

What structural information is still needed to fully understand Tim23 function?

Despite recent advances, several structural questions remain:

  • High-resolution structure of Tim23:

    • Atomic-level details of the channel-forming regions

    • Conformational changes during different functional states

    • Interaction interfaces with other TIM23 complex components

  • Substrate-bound structures:

    • How presequences interact with the channel

    • Conformational changes upon substrate binding

    • Mechanisms of selectivity and gating

  • Integrated complex structures:

    • Organization of the complete TIM23 complex

    • Interaction with the TOM complex during preprotein translocation

    • Association with the PAM complex for matrix protein import

Advanced cryo-EM approaches, potentially combined with site-specific crosslinking and mass spectrometry, may help address these questions and provide a more complete structural understanding of Tim23 function.

How can comparative studies of Tim23 across species enhance our understanding?

Comparative analysis of Tim23 from different organisms, including Danio rerio, can provide valuable insights:

  • Conservation and divergence:

    • Identification of universally conserved residues essential for function

    • Species-specific adaptations that may reflect different physiological requirements

    • Correlation between sequence variations and functional differences

  • Experimental advantages:

    • Zebrafish as a vertebrate model with genetic tractability

    • Developmental studies not possible in other systems

    • Tissue-specific analysis of Tim23 function

  • Evolutionary perspectives:

    • Tracing the evolution of the protein import machinery

    • Understanding adaptations in different lineages

    • Identifying fundamental principles versus specialized adaptations

These comparative approaches provide a broader context for understanding Tim23 function and can highlight features that may be overlooked in studies focused on a single model organism.

What technological advances could drive future Tim23 research?

Several emerging technologies may accelerate our understanding of Tim23:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize TIM23 complex organization in intact mitochondria

    • Single-molecule tracking to follow dynamic changes during translocation

    • Correlative light and electron microscopy to connect function with structure

  • Improved structural methods:

    • Cryo-electron tomography of TIM23 complexes in native membranes

    • Mass spectrometry approaches to map protein interactions and modifications

    • Computational modeling and simulation to predict dynamic behavior

  • Genetic and biochemical tools:

    • CRISPR-based approaches for precise genome editing in model systems

    • Expanded in vitro reconstitution systems with greater complexity

    • Development of specific probes for monitoring Tim23 activity

These technological advances promise to provide new insights into the structure, function, and regulation of Tim23 and the TIM23 complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.