Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Mitochondrial Uncoupling Protein 2

Recombinant Danio rerio Mitochondrial uncoupling protein 2 (ucp2) refers to an artificially produced form of the native UCP2 protein found in zebrafish (Danio rerio). This protein belongs to the superfamily of mitochondrial anion carriers that play a crucial role in dissociating the respiratory chain from ATP synthesis . The recombinant version is produced through expression systems that allow for the isolation and purification of the protein for research applications. UCP2 was initially identified in zebrafish through expressed sequence tag databases at the European Molecular Biology Laboratory, with the cDNA obtained from a "day 0 fin regeneration" cDNA library .

Unlike its mammalian counterpart UCP1, which is primarily involved in thermogenesis, zebrafish UCP2 appears to serve alternative functions, as Danio rerio is an ectothermic vertebrate that does not raise body temperature above ambient by producing excess heat . This fundamental difference suggests that UCP2 evolved for metabolic roles beyond heat production, making the zebrafish model particularly valuable for understanding the ancestral and conserved functions of this protein family.

Comparative Analysis with Other Species

Zebrafish UCP2 shares significant sequence homology with UCP2 proteins from other vertebrates. It exhibits approximately 82% sequence identity with mammalian UCP2s , highlighting the strong evolutionary conservation of this protein. Specifically, zebrafish UCP2 is about 70% identical to mammalian UCP3s and 60% identical to mammalian UCP1s . This graduated similarity pattern reflects the evolutionary relationships between different UCP family members.

Table 1: Sequence Identity of Zebrafish UCP2 Compared to Other Species

SpeciesProteinSequence Identity (%)
Human, Rat, MouseUCP278%
Mammals (average)UCP282%
MammalsUCP370%
MammalsUCP160%
ZebrafishUCP2100%

The high degree of sequence conservation suggests that UCP2 serves fundamental cellular functions that have been maintained throughout vertebrate evolution, despite the different thermoregulatory strategies employed by various species.

Gene Structure

The genomic structure of zebrafish ucp2 follows the typical organization seen in other vertebrates. The gene is composed of 8 exons separated by 7 introns . This structure is conserved across vertebrate species, suggesting functional importance of the gene organization. The zebrafish genome contains the ucp2 gene on chromosome 10 .

According to the Zebrafish Information Network (ZFIN), several transcript variants have been identified for the zebrafish ucp2 gene, including:

Table 2: Transcript Variants of Zebrafish ucp2

TypeNameLength (nt)Analysis Method
mRNAucp2-2011,518 ntEnsembl
ncRNAucp2-002789 ntEnsembl
ncRNAucp2-003779 ntEnsembl
ncRNAucp2-004757 ntEnsembl
ncRNAucp2-005807 ntEnsembl

This diversity of transcript variants suggests potential complexity in the regulation and function of UCP2 in zebrafish .

Expression Pattern

Zebrafish ucp2 shows a wide tissue distribution pattern. According to the ZFIN database, the gene is expressed in several structures including blood, brain, cardiovascular system, pleuroperitoneal region, and ventral mesoderm . This broad expression pattern is consistent with observations in other vertebrates where UCP2 is also widely distributed across tissues, particularly in macrophage-rich tissues and reproductive organs .

The widespread expression of UCP2 across different tissues supports the hypothesis that this protein plays multiple physiological roles beyond thermogenesis, potentially including involvement in immune function, reproduction, and general cellular metabolism.

Metabolite Transport Activity

Research has demonstrated that UCP2 functions primarily as a metabolite transporter rather than simply an uncoupling protein. Studies have shown that UCP2 catalyzes the exchange of specific C4 metabolites (malate, oxaloacetate, and aspartate) for phosphate across the inner mitochondrial membrane .

In reconstitution experiments using lipid vesicles, UCP2 exhibited active transport of phosphate, L-malate, and L-aspartate in homo-exchange reactions (exchange of the same unlabeled substrate) . This specific transport function distinguishes UCP2 from other members of the uncoupling protein family, such as UCP1, which did not show significant transport of these substrates in similar experimental conditions .

Regulation of Mitochondrial Metabolism

UCP2 plays a critical role in regulating substrate oxidation in mitochondria. By exporting C4 metabolites from mitochondria to the cytosol, UCP2 affects the metabolic flux through the citric acid cycle and influences cellular energy production .

Studies with UCP2-silenced human hepatocellular carcinoma (HepG2) cells have shown that compared to wild-type cells, UCP2-silenced cells grown in glucose exhibit:

  • Higher inner mitochondrial membrane potential

  • Higher ATP:ADP ratio

  • Lower lactate release

  • Higher levels of citric acid cycle intermediates in the mitochondria

These findings suggest that UCP2 expression limits mitochondrial glucose oxidation and promotes a metabolic shift toward glutaminolysis. This metabolic reprogramming function may explain UCP2's involvement in various physiological and pathological processes such as insulin secretion, stem cell differentiation, cancer, and aging .

Non-thermogenic Functions

The presence of UCP2 in ectothermic vertebrates like zebrafish provides compelling evidence that this protein evolved for functions beyond thermogenesis . Since zebrafish do not generate heat to maintain body temperature above ambient, their UCP2 must serve alternative physiological roles. These may include regulation of reactive oxygen species (ROS) production, calcium homeostasis, or metabolic substrate selection .

Metabolic Regulation

Research comparing UCP2 expression patterns across species suggests a conserved role in metabolic regulation. In fasting-refeeding experiments conducted in rainbow trout (another fish species with two UCP2 genes), different expression patterns were observed for UCP2A and UCP2B in muscle tissue. UCP2B expression increased during fasting and decreased after refeeding, similar to patterns observed in mammals . Interestingly, UCP2A showed the opposite pattern, decreasing during fasting, which suggests potentially different metabolic roles for these two forms in fish muscle .

The differential regulation of UCP2 genes in response to nutritional status highlights their importance in energy homeostasis and substrate utilization, even in ectothermic species. This conservation of metabolic functionality across diverse vertebrates points to an ancient evolutionary origin for these roles.

Research Applications

Recombinant zebrafish UCP2 serves as a valuable tool for investigating several aspects of mitochondrial biology:

  1. Comparative studies of UCP function across vertebrate evolution

  2. Structure-function analyses of mitochondrial carrier proteins

  3. Investigations of metabolite transport mechanisms

  4. Studies on the regulation of cellular metabolism and energy homeostasis

  5. Research on the non-thermogenic functions of uncoupling proteins

The availability of purified recombinant protein facilitates biochemical assays, reconstitution experiments, and structural analyses that enhance our understanding of this important mitochondrial transporter.

Phylogenetic Relationships

Phylogenetic analyses including UCP genes from various species have positioned zebrafish UCP2 with its orthologs from other vertebrates. These analyses support the hypothesis of an early divergence of vertebrate UCPs from a common ancestor gene . The high sequence similarity between fish and mammalian UCP2 (approximately 78-83%) indicates strong evolutionary conservation of this protein over hundreds of millions of years of vertebrate evolution .

Functional Evolution

The presence of UCP2 in ectothermic vertebrates like zebrafish provides evidence for the primordial functions of this protein family before the evolution of thermogenesis. By studying zebrafish UCP2, researchers can gain insights into the ancestral roles of uncoupling proteins, which likely included metabolite transport and regulation of redox balance before being coopted for heat production in mammals .

This evolutionary perspective helps explain why UCP2 is widely expressed across tissues and involved in diverse physiological processes, as it likely evolved first as a metabolic regulator before some members of the family specialized for thermogenic functions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your needs.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ucp2; slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGENKASTNMGRGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSDHAGIGSR LMAGCTTGAMAVAVAQPTDVLKVRFQAQVSAGASKRYHSTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTIIASPVDVVK TRYMNSAQGQYSSALNCAVAMLTKKGPKAFFKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARQNWHTPL
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation from ATP synthesis. This results in energy dissipation as heat.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic structure and organization of UCP2 in Danio rerio?

UCP2 in Danio rerio belongs to the superfamily of mitochondrial anion carriers that dissociate the respiratory chain from ATP synthesis. The genomic structure of UCP2 in zebrafish follows the pattern observed in other vertebrates, consisting of 8 exons and 7 introns. Based on comparative analysis with rainbow trout (Oncorhynchus mykiss), which has two UCP2 genes (UCP2A and UCP2B), it's reasonable to infer that zebrafish UCP2 likely shares similar structural features . The zebrafish UCP2 gene exhibits approximately 83% amino acid similarity with rainbow trout UCP2 .

Like other UCPs, zebrafish UCP2 contains six transmembrane domains and three proton carrier signatures that define the general triplicate structure of mitochondrial uncoupling proteins. The protein also includes a purine-binding domain involved in the control of coupling efficiency .

How does zebrafish UCP2 function differ from mammalian UCP2?

Despite structural similarities, zebrafish UCP2 exhibits some functional differences compared to mammalian UCP2:

  • Uncoupling activity: While mammalian UCP2 has been associated with proton conductance (though this remains controversial), zebrafish UCP2 function appears to be more focused on regulation of reactive oxygen species (ROS) and mitochondrial metabolism .

  • Regulatory elements: Comparison of regulatory regions between fish and mammalian UCP2 genes reveals that certain transcription factor binding sites are conserved across species, while others differ significantly. Binding sites for ADR1, CAP, CdxA, and HSF are identified in upstream regions of both fish and mammalian UCP2 genes, but sites for AML1a, MZF, and USF are present in mouse and human sequences yet absent in fish .

  • Response to environmental factors: Zebrafish UCP2 shows notable upregulation during cellular stress, particularly in response to pharmaceutical compounds like selective serotonin reuptake inhibitors (SSRIs), suggesting its importance in neurological stress responses .

What is the tissue distribution pattern of UCP2 in zebrafish?

While the search results don't provide comprehensive information specifically on zebrafish UCP2 tissue distribution, data from rainbow trout (another teleost fish) can provide relevant insights. In rainbow trout, UCP2 genes are widely expressed across tissues with predominant levels in macrophage-rich tissues and reproductive organs .

Based on the experimental data available, zebrafish UCP2 is notably expressed in neural tissues, as evidenced by studies examining UCP2 expression in larval zebrafish brains exposed to SSRIs . This neural expression pattern aligns with findings in mammals where UCP2 plays important roles in brain function and neurological processes.

How does UCP2 respond to environmental stressors in Danio rerio?

UCP2 in zebrafish shows significant responsiveness to environmental stressors, particularly pharmaceutical compounds. A study using RNA-sequencing methods demonstrated that exposure to selective serotonin reuptake inhibitors (SSRIs) - specifically fluoxetine and paroxetine at 100 μg/L for 6 days - resulted in substantial upregulation of ucp2 in larval zebrafish brains .

This upregulation of UCP2 appears to be part of a compensatory response to mitigate oxidative stress and potential mitochondrial dysfunction induced by these compounds. The researchers noted that UCP2 was "highly upregulated with SSRI exposure" in their dataset, suggesting it serves as a sensitive marker for certain types of cellular stress in zebrafish .

The specific response pattern indicates that zebrafish UCP2 may function as part of a protective mechanism against oxidative damage, similar to its role in mammalian systems where UCP2's antioxidant activity has been directly linked to neurogenesis and mitochondrial respiration .

What controversies exist surrounding UCP2's uncoupling activity in fish models?

The uncoupling activity of UCP2 remains highly controversial across species, including fish models. Several key points of contention should be considered when working with recombinant zebrafish UCP2:

  • Structural considerations: While UCP2 shows homology to UCP1 (which has established uncoupling function), key differences exist. UCP2 lacks the histidine residues (His-145 and His-147) that are essential for UCP1's protonophore activity, suggesting that if UCP2 performs uncoupling, it uses a different mechanism .

  • Artifactual uncoupling: Many studies reporting uncoupling activity were performed under artificial overexpression conditions in yeast and bacterial systems. This approach has been criticized because overexpression can prevent proteins from reaching their correct conformation, potentially leading to uncontrolled artifactual uncoupling that doesn't reflect physiological reality .

  • Antibody specificity issues: Studies investigating UCP2 function have frequently used commercial antibodies that were later shown to be nonspecific for UCP2 protein detection. This raises questions about the reliability of some reported findings .

  • Replication challenges: Many experiments supporting uncoupling activity have not been successfully replicated. For example, studies have described UCP2 activity in renal tissue where UCP2 could never be detected, casting doubt on these findings .

When designing experiments with recombinant zebrafish UCP2, researchers should be aware of these controversies and carefully validate their methodological approaches, particularly regarding protein detection methods and expression systems.

How does UCP2 influence neurodevelopment and neuroprotection in zebrafish?

UCP2 plays a significant role in zebrafish neurodevelopment and neuroprotection through several mechanisms:

  • Mitochondrial function regulation: UCP2 serves as an important regulator of mitochondrial metabolism, controlling ATP and reactive oxygen species production in neural tissues .

  • Response to neurological stressors: Research demonstrates that UCP2 is highly upregulated in response to SSRI exposure in larval zebrafish brains, suggesting a protective response to neurological stress .

  • Neurogenesis implications: Based on mammalian studies, UCP2's antioxidant activity is directly linked to neurogenesis. UCP2 knockout mice show more severe depressive symptoms, decreased neurogenesis, and enhanced loss of astrocytes and dendritic spines—effects that are partially rescued by expressing UCP2 . While direct evidence in zebrafish is more limited, the conservation of these pathways suggests similar mechanisms may be at work.

  • Connection to broader neural pathways: Differential gene expression analysis identified that UCP2 regulation is part of a broader response involving mitochondrial and neuronal structures, mitochondrial respiration, and neurodevelopmental processes in zebrafish exposed to SSRIs .

These findings suggest that recombinant zebrafish UCP2 could be a valuable tool for studying neuroprotective mechanisms and neurodevelopmental processes, particularly in the context of environmental stressors or pharmaceutical compounds.

What methodological considerations are important when working with recombinant Danio rerio UCP2?

When working with recombinant Danio rerio UCP2, several critical methodological considerations should be addressed:

  • Antibody validation: Given the documented issues with commercial UCP2 antibodies, researchers should carefully validate any antibody used for detection. Consider using knockout controls or comparing results with established specific antibodies like the UCP2-605 homemade polyclonal antibody developed by Pecqueur et al., which has been validated in multiple studies .

  • Expression systems: Be cautious with overexpression systems, as they may produce artifactual results. The artificial overexpression of UCP carriers in yeast and bacterial systems has been shown to prevent proteins from reaching their correct conformation, leading to uncontrolled uncoupling that doesn't reflect physiological conditions .

  • Translational regulation: Remember that UCP2 is translationally regulated, meaning that mRNA expression levels don't necessarily correlate with protein levels. Both transcriptional and translational analyses should be performed for comprehensive results .

  • Activation parameters: When studying potential activating compounds (like retinoic acid, fatty acids, or ROS), consider physiological relevance of concentrations. Some studies have used micromolar concentrations of activators that are unlikely to be physiologically relevant .

  • Functional assays: When assessing UCP2 function, combine multiple approaches rather than relying solely on a single method. Consider measuring parameters like ROS production, mitochondrial membrane potential, and cellular respiration to build a comprehensive picture of UCP2 activity.

What approaches are most effective for studying UCP2 function in Danio rerio?

For studying UCP2 function in zebrafish, several complementary approaches are recommended:

  • RNA-sequencing: Ultra-low input RNA-sequencing methods have proven effective for identifying UCP2 expression changes in response to environmental factors. This approach was successfully used to identify UCP2 upregulation in larval zebrafish brains exposed to SSRIs .

  • Differential gene expression analysis: This approach can identify genes significantly affected by experimental conditions and reveal co-expression networks associated with UCP2 function. In SSRI exposure studies, differential gene expression analysis identified 1550 genes significantly affected, with UCP2 as a key component .

  • Weighted gene co-expression network analysis: This method can identify modules of genes whose expression patterns correlate with UCP2 expression under various conditions, providing insights into functional networks .

  • Functional enrichment analysis: This approach helps identify biological processes associated with UCP2 function. Studies in zebrafish have used this method to connect UCP2 to mitochondrial and neuronal structures, mitochondrial respiration, and neurodevelopmental processes .

  • Comparative genomics: Analyzing the genomic structure, phylogenetic relationships, and regulatory elements of UCP2 across species can provide valuable insights. Studies comparing rainbow trout and zebrafish UCP2 have yielded important information about evolutionary relationships and conserved functional elements .

How can recombinant UCP2 be used to study oxidative stress responses in zebrafish?

Recombinant zebrafish UCP2 can be a powerful tool for studying oxidative stress responses through several experimental approaches:

  • In vitro reconstitution systems: Purified recombinant UCP2 can be incorporated into liposomes or proteoliposomes to study its direct effects on proton conductance and membrane potential in a controlled environment .

  • Cell-based assays: Recombinant UCP2 can be expressed in zebrafish cell lines to study its effects on ROS production, mitochondrial membrane potential, and cellular responses to oxidative stress inducers.

  • Rescue experiments: In UCP2-deficient zebrafish models (created through CRISPR-Cas9 or morpholino approaches), recombinant UCP2 can be introduced to assess whether it rescues phenotypes associated with increased oxidative stress.

  • Structure-function studies: Recombinant UCP2 with specific mutations can help identify domains crucial for its antioxidant function and distinguish between direct and indirect effects on ROS production.

  • Interaction studies: Recombinant UCP2 can be used to identify binding partners and regulatory molecules that modulate its antioxidant activity in zebrafish, potentially revealing novel therapeutic targets.

When designing these experiments, researchers should consider the controversies surrounding UCP2 function and carefully validate their experimental systems to ensure physiologically relevant results.

How do researchers reconcile contradictory findings about UCP2 function across different model systems?

The scientific literature contains numerous contradictions regarding UCP2 function, requiring careful analysis when interpreting results:

  • Species-specific differences: While UCP2 is conserved across vertebrates, functional differences exist between species. Zebrafish UCP2 shows approximately 83% amino acid similarity with rainbow trout UCP2 and 78% similarity with human, rat, and mouse UCP2s . These differences may account for some functional variations.

  • Methodological considerations: Many contradictions stem from methodological differences:

    • Overexpression systems versus physiological expression levels

    • Use of non-specific antibodies

    • Different activation conditions and concentrations of modulators

    • Varied tissue preparations and isolation methods

  • Contextual function: UCP2 may have different functions depending on cellular context and physiological state. In zebrafish exposed to SSRIs, UCP2 appears to serve a protective function against oxidative stress , while other studies suggest roles in energy metabolism regulation.

  • Translational regulation: UCP2 is subject to tight translational regulation, meaning mRNA levels don't always correlate with protein expression. Studies focusing solely on transcriptional analysis may yield contradictory results compared to protein-level analyses .

To reconcile these contradictions, researchers should:

  • Clearly define the experimental context and model system

  • Use multiple complementary approaches to study UCP2 function

  • Validate key findings using both gain-of-function and loss-of-function approaches

  • Consider evolutionary conservation and divergence when comparing across species

What are the key debates about UCP2's role in mitochondrial function in zebrafish?

Several key debates exist regarding UCP2's role in zebrafish mitochondrial function:

  • Uncoupling versus ROS regulation: Whether zebrafish UCP2 primarily functions as an uncoupling protein or as a regulator of reactive oxygen species remains contentious. Evidence from studies in other species suggests that UCP2 may primarily function to regulate ROS production rather than as a classical uncoupler .

  • Direct versus indirect effects: There is debate about whether UCP2 directly modulates proton conductance or indirectly affects mitochondrial function through other mechanisms, such as metabolite transport or interaction with other proteins.

  • Developmental regulation: The role of UCP2 in zebrafish development, particularly neurodevelopment, remains an area of active investigation. Studies showing UCP2 upregulation in response to SSRI exposure suggest important developmental functions that are still being characterized .

  • Physiological activators: The identity of physiological activators of zebrafish UCP2 remains unclear. While fatty acids, ROS, and other molecules have been proposed as activators in mammalian systems, their relevance to zebrafish UCP2 is not fully established .

  • Experimental artifacts: There is ongoing debate about whether some observed UCP2 functions, particularly uncoupling activity, may represent experimental artifacts rather than physiological functions .

These debates highlight the need for careful experimental design when studying zebrafish UCP2, with attention to physiological relevance and appropriate controls.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.