Recombinant Danio rerio Mpv17-like protein 2 (mpv17l2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondria

MPV17L2 is evolutionarily conserved and critical for mitochondrial protein synthesis. Its primary functions include:

Mitochondrial Ribosome Assembly

  • Subunit Integration: MPV17L2 facilitates the assembly of mitochondrial ribosomal subunits (mtSSU and mtLSU) into translationally competent monosomes .

  • Nucleoid Interactions: The protein associates with mitochondrial nucleoids, where mtDNA is replicated and transcribed, and interacts with the large ribosomal subunit (mtLSU) during ribosome maturation .

  • Dependence on mtDNA: MPV17L2 expression is mtDNA-dependent; its absence in ρ0 cells (devoid of mtDNA) highlights its role in linking ribosome biogenesis to mtDNA maintenance .

Impact of Gene Silencing

  • Ribosomal Deficits: Depletion of MPV17L2 reduces monosome formation, disrupts mtLSU and mtSSU stability, and impairs mitochondrial translation .

  • mtDNA Aggregation: Loss of MPV17L2 leads to mtDNA nucleoid clustering, trapping mtSSU components and exacerbating translational defects .

Experimental Models

Model OrganismObservationSource
Human CellsMPV17L2 knockdown causes ribosomal subunit imbalance and mtDNA aggregation.
Zebrafishmpv17l2 mutations linked to mitochondrial dysfunction, though direct phenotypes are less characterized.

Key Discoveries

  1. Paralog Distinction: Unlike its paralog MPV17 (involved in mtDNA maintenance), MPV17L2 is specialized for ribosome assembly and translation .

  2. Nucleotide Metabolism: While MPV17 is implicated in purine/pyrimidine transport, MPV17L2’s role in ribosome biogenesis suggests indirect effects on nucleotide availability via mtDNA replication .

Comparative Analysis with MPV17

The MPV17 family includes four members: MPV17, MPV17L, MPV17L2, and PXMP2. Below is a functional comparison:

ProteinLocalizationPrimary FunctionmtDNA Dependency
MPV17IMMmtDNA maintenance, purine metabolismNo
MPV17L2IMMRibosome assembly, translationYes
PXMP2Peroxisomal membraneSmall solute transportNo

MPV17L2’s mtDNA dependency and ribosomal role distinguish it from MPV17, which is linked to mtDNA depletion syndromes in humans .

Therapeutic and Diagnostic Potential

While recombinant mpv17l2 is primarily a research tool, its study informs mitochondrial disorders:

  • Ribosomal Defects: Insights into diseases caused by impaired mitochondrial translation (e.g., sideroblastic anemia).

  • mtDNA Dynamics: Potential therapeutic targets for managing mtDNA aggregation in neurodegenerative diseases.

Challenges and Future Directions

  • Mechanistic Gaps: The exact molecular mechanism of MPV17L2 in ribosome-mtDNA interactions remains unclear.

  • Zebrafish Models: Further studies are needed to validate mpv17l2’s role in iridophore development, as mpv17 mutants in zebrafish show pigmentation defects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mpv17l2; zgc:92754; Mpv17-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
mpv17l2
Target Protein Sequence
MISRQGKEFLVRIAGYWKPLFRGRFLIVTNTVSCGGMLAAGDLIQQTREIRRTPGRTRDW SRTGCMFAVGCSMGPFMHYWYQWLDKYFIGNGINNVCKKVLVDQLVASPTLGAWYFLGMG MMEGHTFIEAQQEFRDKFWEFYKADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYL SYLKHRDTVEVTKEADGTA
Uniprot No.

Target Background

Function
Essential for mitochondrial ribosome assembly and stability; acts as a positive regulator of mitochondrial protein synthesis.
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion inner membrane.

Q&A

What is mpv17l2 and how does it differ from mpv17 in zebrafish?

Mpv17-like protein 2 (mpv17l2) is a paralogue of mpv17, both belonging to a conserved family of integral membrane proteins. In zebrafish, mpv17l2 is located on chromosome 19 and encodes a mitochondrial inner membrane protein . Unlike mpv17 (which has a primary role in mtDNA maintenance), mpv17l2 contributes to mitochondrial ribosome biogenesis .

Phylogenetic analysis indicates that gene duplication events in early metazoan evolution gave rise to the mpv17, mpv17-like, and mpv17-like2 paralogues, with mpv17l2 showing the highest sequence similarity to mpv17 . The key functional difference is that mpv17l2 is dependent on mtDNA (absent from ρ0 cells) and associates with the large subunit of the mitochondrial ribosome, while mpv17 does not co-sediment with either ribosomal subunit .

What expression patterns does mpv17l2 show during zebrafish development?

Mpv17l2 shows a liver-specific localization pattern in wild-type zebrafish larvae at 3 dpf (days post-fertilization). Interestingly, in mpv17-/- knockout larvae, mpv17l2 exhibits wider expression patterns beyond the liver, suggesting compensatory upregulation when mpv17 is absent . RT-qPCR analysis confirms significant overexpression of mpv17l2 in mpv17-/- larvae at 6 dpf, while mpv17-like (mpv17l) expression remains unchanged .

This expression pattern change may represent an evolutionary compensatory mechanism, as demonstrated by the following data:

GeneExpression in Wild-Type (Relative Level)Expression in mpv17-/- (Relative Level)Change
mpv171.00-100%
mpv17l1.01.0 (unchanged)0%
mpv17l21.0Significantly increased+50-70%

What methods are recommended for recombinant expression of Danio rerio mpv17l2?

Recombinant mpv17l2 can be successfully expressed using several expression systems, each with specific advantages:

  • E. coli expression system: Offers highest yield and shortest turnaround time . Recommended for structural studies requiring high protein quantities. The full-length mpv17l2 cDNA from wild-type zebrafish can be subcloned into bacterial expression vectors using In-Fusion® HD Cloning Kit .

  • Yeast expression system: Provides good yields with some post-translational modifications . Useful for functional studies requiring properly folded protein.

  • Insect cells with baculovirus: Recommended when mammalian-like post-translational modifications are required .

  • Mammalian cell expression: Optimal for retaining complete protein activity and native folding . HEK293T cells have been successfully used for mpv17l2 expression studies .

For purification, a common approach is affinity chromatography using epitope tags. Mitochondrial membrane proteins like mpv17l2 require careful optimization of detergent conditions to maintain proper folding during solubilization from membranes.

How can CRISPR/Cas9 be optimized for generating mpv17l2 knockout zebrafish models?

Creating mpv17l2 knockout zebrafish requires careful design and validation:

  • Guide RNA design: Use bioinformatic resources like CRISPOR or ZIFIT Targeter for designing crRNAs targeting exons of the mpv17l2 gene . Target early exons to ensure complete protein disruption.

  • Ribonucleoprotein complex assembly: Anneal crRNA:tracrRNA heteroduplex (150 picomoles each) by cooling from 95°C to 30°C at 5°C per minute, then mix with 10 μg of recombinant Cas9 for 10 minutes at room temperature .

  • Microinjection: Inject into single-cell stage embryos using nucleofector solution .

  • Screening strategy:

    • Perform T7E1 assay to confirm genome editing success

    • Create limiting dilution of cells for single-cell isolation

    • Expand clones and perform Sanger sequencing to identify mutations

    • Confirm knockout at protein level using mass spectrometry

  • Validation: Assess both genotype and phenotype, comparing to known mpv17 mutants (roy orbison, transparent) to identify unique mpv17l2 knockout features .

What is the role of mpv17l2 in mitochondrial ribosome assembly?

Mpv17l2 is crucial for mitochondrial ribosome assembly and function. Based on human MPV17L2 studies, which are likely applicable to the zebrafish orthologue, mpv17l2:

  • Co-sediments specifically with the large subunit of the mitochondrial ribosome (mtLSU) and the monosome

  • Contributes to the biogenesis of the mitochondrial ribosome by uniting the two subunits to create the translationally competent monosome

  • When depleted, causes:

    • Marked decreases in both subunits of the mitochondrial ribosome and the monosome

    • Impaired protein synthesis in mitochondria

    • Mitochondrial DNA aggregation

Immunoprecipitation experiments with tagged components of mitochondrial ribosomes show that mpv17l2 associates specifically with the mtLSU but not with the small subunit (mtSSU) . This selective association suggests mpv17l2 plays a bridging role between ribosomal subunits.

How does mpv17l2 function relate to mitochondrial DNA maintenance?

While mpv17 has a direct role in mtDNA maintenance, mpv17l2's relationship with mtDNA appears to be more complex:

  • Nucleoid interaction: Depletion of mpv17l2 induces mitochondrial DNA aggregation, suggesting a role in proper nucleoid distribution .

  • Assembly site evidence: Research suggests the assembly of the small subunit of the mitochondrial ribosome occurs at the nucleoid, with mpv17l2 potentially mediating this process .

  • mtDNA dependency: Unlike mpv17, mpv17l2 is absent from ρ0 cells (lacking mtDNA), indicating its expression depends on the presence of mitochondrial DNA .

  • Compensatory relationship: In mpv17-/- zebrafish, mpv17l2 is upregulated, suggesting it may partially compensate for loss of mpv17's role in mtDNA maintenance , though the mechanisms differ.

How do mpv17 and mpv17l2 knockouts in zebrafish compare to mammalian models?

Key differences exist between zebrafish and mammalian models of mpv17/mpv17l2 deficiency:

FeatureZebrafish mpv17-/-Mouse Mpv17-/-Human MPV17 mutations
ViabilityViable with normal lifespan (roy/tra strains) but newly engineered knockouts show reduced survival Variable survival (18 weeks to 1-2 years) Often fatal in infancy due to liver failure
Primary phenotypeLack of iridophores (reflective skin cells) Glomerulosclerosis, nephrotic syndrome, inner ear defects Hepatocerebral form of mtDNA depletion syndrome
Mitochondrial defectsMitochondrial cristae disorder, reduced ATP content , elevated ROS and mitochondrial Ca2+ mtDNA depletion Severe mtDNA depletion (1-40% of normal)
Tissue specificityMuscle, liver defects in newer knockout models Kidney, inner ear (incl. outer hair cells) Primarily liver, also neurological manifestations

Unlike mpv17, less comparative data exists for mpv17l2 knockouts across species. In zebrafish research, the study of mpv17l2 has primarily focused on its compensatory upregulation in mpv17-/- mutants .

How can zebrafish mpv17l2 models contribute to understanding human mitochondrial diseases?

Zebrafish mpv17l2 models offer unique advantages for studying mitochondrial diseases:

  • Developmental visibility: Transparent zebrafish embryos allow real-time visualization of mitochondrial dynamics and developmental effects of mpv17l2 manipulation .

  • Rescue experiments: Zebrafish mpv17-/- models allow testing of rescue by mpv17l2 overexpression or by introducing human MPV17 or MPV17L2 , providing insights into functional conservation and potential therapeutic approaches.

  • Combined genetic approaches: The ability to simultaneously manipulate mpv17 and mpv17l2 can reveal interaction effects relevant to human disease mechanisms .

  • Drug screening: Zebrafish models permit testing of compounds like orotic acid, which was found to ameliorate the phenotype of mpv17 null mutants by increasing mtDNA content , potentially informing therapies for MPV17-related diseases.

  • Mitochondrial rescue: Studies show exogenous mitochondria injection can recover genes involved in TAG metabolism pathways in mpv17-/- zebrafish , offering innovative therapeutic directions.

What are current approaches for studying mpv17l2 protein interactions within the mitochondrial membrane?

Advanced techniques for studying mpv17l2 interactions include:

  • BioID technology: This proximity-dependent biotin identification approach has been successfully used for MPV17 and could be adapted for mpv17l2 to identify interacting partners in the mitochondrial inner membrane .

  • Co-immunoprecipitation with ribosomal components: Using tagged components of the mitochondrial ribosome (e.g., ICT1-FLAG for mtLSU) to pull down mpv17l2 and identify stable interactions .

  • Sucrose gradient analysis: To study co-sedimentation of mpv17l2 with ribosomal components and nucleoids .

  • Fluorescence microscopy with mitochondrial markers: Using reporters like mito-roGFP2-ORP1 to visualize mpv17l2 localization relative to other mitochondrial compartments .

  • Cross-linking mass spectrometry: To capture transient interactions between mpv17l2 and its binding partners within the mitochondrial membrane.

The major challenge is maintaining the native membrane environment during solubilization and developing appropriate controls to distinguish specific from non-specific interactions.

What methodological challenges exist in crystallizing recombinant mpv17l2 for structural studies?

Structural studies of mpv17l2 face several significant challenges:

  • Membrane protein crystallization barriers:

    • Detergent selection is critical for extracting mpv17l2 from membranes without disrupting structure

    • The presence of multiple transmembrane domains creates hydrophobic surfaces that inhibit crystal formation

    • Protein flexibility, particularly in loop regions, can prevent uniform crystal packing

  • Expression challenges:

    • High-level expression of functional membrane proteins often leads to toxicity or inclusion body formation

    • Post-translational modifications may differ between expression systems and native protein

  • Alternative approaches:

    • Cryo-electron microscopy may overcome some crystallization challenges

    • Lipid cubic phase crystallization has shown success with other membrane proteins

    • Using chimeric constructs with soluble proteins to facilitate crystallization

    • Nanobody-aided crystallization to stabilize flexible regions

  • Functional validation:

    • Any structural studies must be complemented with functional assays to ensure the recombinant protein maintains native activity

    • Channel activity can be assessed by reconstitution in liposomes to measure ion flux, similar to studies done with MPV17

How might studying the relationship between mpv17l2 and pyrimidine metabolism lead to novel therapeutic approaches?

Recent findings suggest promising connections between mpv17l2, pyrimidine metabolism, and potential therapies:

  • Pyrimidine pathway connection: Research indicates that inhibition of Dihydroorotate dehydrogenase (Dhodh) by leflunomide affects iridophore and melanophore formation in zebrafish, similar to mpv17 mutations . This suggests a relationship between mpv17 function and pyrimidine synthesis.

  • Co-regulation evidence: Human MPV17 shows strong co-regulation (66.48% concordance, Pearson coefficient 0.504) with the CAD enzyme involved in pyrimidine production .

  • Orotic acid rescue: Administration of orotic acid (OA), a pyrimidine precursor and food supplement, significantly improved the phenotype of mpv17 null mutants, increasing both iridophore numbers and mtDNA content .

  • Therapeutic implications: These findings open potential therapeutic avenues:

    • Targeted supplementation with specific nucleotide precursors

    • Modulation of pyrimidine synthesis pathways

    • Development of compounds that enhance mpv17l2 function to compensate for mpv17 deficiency

  • Research methodology: To further explore this connection, researchers can:

    • Perform metabolomic profiling of mpv17l2 knockouts

    • Conduct rescue experiments with various pyrimidine pathway metabolites

    • Use CRISPR-Cas9 to simultaneously target mpv17l2 and pyrimidine synthesis genes

    • Develop high-throughput screening platforms using zebrafish embryos to identify compounds that modulate this pathway

This research direction could yield significant insights into treating mitochondrial DNA depletion syndromes by focusing on metabolic interventions rather than direct gene replacement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.