Recombinant Danio rerio N-acetylaspartate synthetase (nat8l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
nat8l; zgc:162648; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
nat8l
Target Protein Sequence
MHCSSPKMVCETKIVADEHEAIAGTKKDSIIVSSSQMWTSSSASPSALESKIEKRNQVFI REFERSDHEEVRRIFNEGIMERIPNSAFRGLKQQTTTQFMYAFLTVMCYVMTKSFTLTFC APFILMGARYYYSRKVILSYLDCALHTDMADIEAYYMKPTGSCFWVAVLQGQVVGIVAAQ SREDDNTVELRRMSVDSHFRGKGIAKALGRRVIEFAMLNNYSAVVLGTTAVKMAAHKLYE SLGFRRVGETEDYTLPGMTRSPLERLFFQIRYSHYRLQLHEE
Uniprot No.

Target Background

Function

Background Function: N-acetylaspartate synthetase (NAT8L) may regulate lipogenesis through the production of N-acetylaspartate (NAA), a brain-specific metabolite. It may also enhance dopamine uptake by modulating TNF-alpha expression.

Database Links
Protein Families
Camello family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is N-acetylaspartate synthetase (nat8l) and what is its primary function?

N-acetylaspartate synthetase (nat8l) is an enzyme that catalyzes the synthesis of N-acetylaspartate (NAA) from L-aspartate and acetyl-CoA. In zebrafish (Danio rerio), as in mammals, nat8l is crucial for the production of NAA, which is one of the most abundant molecules in the vertebrate central nervous system. The enzyme belongs to the N-acetyltransferase (NAT) superfamily and specifically to the camello family. Structurally, the Danio rerio nat8l is a 282 amino acid protein with conserved sequences characteristic of the GCN5 or NAT superfamily of N-acetyltransferases . To study this enzyme properly, researchers should first verify its enzymatic activity by measuring NAA production in controlled reactions containing L-aspartate, acetyl-CoA, and the purified enzyme.

How does zebrafish nat8l compare structurally to human NAT8L?

Zebrafish nat8l shares significant sequence homology with human NAT8L, making it a valuable model for studying NAA metabolism. The full-length protein sequence of Danio rerio nat8l (282 amino acids) contains highly conserved functional domains present in human NAT8L, particularly in the catalytic region. Key differences exist primarily in the N-terminal regulatory regions. When aligning these sequences, researchers should focus on the conserved catalytic residues that form the active site to ensure that functional studies in zebrafish remain relevant to human neurological conditions. Experimental approaches comparing enzyme kinetics between species require careful control of reaction conditions to account for species-specific optimal temperature and pH ranges .

What is the significance of NAA in neurological systems?

NAA is the most abundant dipeptide in the vertebrate central nervous system and serves as a major storage and transport form of acetyl coenzyme A specific to the nervous system. Studies have demonstrated that NAA deficiency (hypoacetylaspartia) caused by mutations in the NAT8L gene is associated with neurological disorders. In zebrafish models, NAA levels have been shown to fluctuate during embryonic development, with significant decreases observed under various stress conditions. Researchers investigating NAA function should employ techniques such as high-resolution magic-angle spinning nuclear magnetic resonance (HRMAS NMR) on intact zebrafish embryos to track changes in NAA levels during development or under experimental conditions .

What expression systems are most effective for producing recombinant Danio rerio nat8l?

E. coli expression systems have been successfully used to produce recombinant Danio rerio nat8l in its active form. Specifically, BL21(DE3)pLysS strains have shown good results for His-tagged RIMKLA (a related enzyme), while BL21 GroE strains have been effective for similar proteins. When designing expression vectors, researchers should consider:

  • Adding an N-terminal His-tag to facilitate purification

  • Using a strong promoter such as T7

  • Optimizing codon usage for E. coli

  • Including appropriate signal sequences if membrane localization is required

The expression should be induced at optimal conditions (typically IPTG at 0.5-1 mM, 18-25°C for 16-20 hours) to maximize soluble protein yield and minimize inclusion body formation .

What purification strategy yields the highest purity and activity for recombinant nat8l?

A multi-step purification strategy is recommended for obtaining high-purity, active recombinant nat8l:

  • Initial capture using DEAE-Sepharose with buffer A (25 mM Hepes, pH 7.1, containing protease inhibitors)

  • Application of a linear gradient (0 to 0.5 M NaCl) for elution

  • Secondary purification using Q-Sepharose with buffer B (25 mM Tris, pH 8.0, 1 mM DTT)

  • Size exclusion chromatography using S-200 gel filtration equilibrated with buffer C (25 mM Hepes, pH 7.1, 200 mM NaCl, 1 mM DTT)

For His-tagged versions, researchers can substitute the Q-Sepharose step with HisTrap column chromatography. Throughout purification, enzyme activity should be monitored using radiochemical assays with labeled substrates. Final preparations typically achieve >90% purity as determined by SDS-PAGE .

How should recombinant nat8l be stored to maintain maximum activity?

For optimal storage of recombinant nat8l:

  • Prepare aliquots in storage buffer containing Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Add glycerol to a final concentration of 50% for long-term storage

  • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

  • For working solutions, maintain at 4°C for up to one week

Researchers should validate enzyme activity after storage by conducting activity assays before experimental use. Reconstitution of lyophilized preparations should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What are the recommended methods for measuring nat8l enzymatic activity?

Radiochemical assays provide the most sensitive quantification of nat8l activity. A standard assay mixture should contain:

  • 25 mM Tris, pH 8.0

  • 5 mM DTT

  • 5 mM MgATP

  • 5 mM MgCl₂

  • 1 mM EGTA

  • 50,000 cpm L-[U-¹⁴C]glutamate

  • L-glutamate (0.05 to 1 mM)

  • 1 mg/ml BSA

  • 5 mM N-acetylaspartate (NAA) or citrate as substrate

After incubation at 30°C for 30 minutes, the reaction should be terminated by heating at 80°C for 5 minutes. Product separation can be achieved using Dowex AG1-X8 column chromatography, with unreacted glutamate eluted with 150 mM NaCl and the product (NAAG or β-citrylglutamate) eluted with 500 mM NaCl. Quantification via liquid scintillation counting will determine specific activity in units per mg protein .

How can the structure and identity of enzymatically produced NAA be confirmed?

Confirmation of NAA structure requires a multi-analytical approach:

  • Mass Spectrometry (MS):

    • Use LCQ Deca XP ion-trap spectrometer with electrospray ionization

    • Operate in positive mode with automatic gain control

    • Perform MS/MS analysis with collision-induced dissociation (25% relative collision energy)

  • NMR Analysis:

    • Prepare purified samples in H₂O/D₂O (9:1)

    • Record spectra on 400-800 MHz spectrometers

    • Analyze ¹H and ¹³C chemical shifts referenced to standard compounds

  • Chromatographic Verification:

    • Purify enzymatic products on AG1-X8 Dowex columns

    • Apply NaCl gradient elution (0 to 1 M)

    • Desalt positive fractions on Bio-Gel P2 columns

This comprehensive analysis ensures accurate identification of NAA and distinguishes it from similar metabolites .

How can recombinant nat8l be used to study NAA metabolism in zebrafish development?

Researchers can employ recombinant nat8l in multiple experimental paradigms:

  • Enzyme Kinetics Studies:

    • Determine Km and Vmax values for different substrates

    • Assess effects of potential inhibitors or activators

    • Compare enzymatic parameters across developmental stages

  • Metabolic Profiling:

    • Use high-resolution magic-angle spinning nuclear magnetic resonance (HRMAS NMR) with intact embryos

    • Correlate NAA levels with specific developmental events

    • Track changes in NAA and related metabolites during development

  • Functional Complementation:

    • Generate nat8l knockdown/knockout zebrafish models

    • Introduce recombinant nat8l at specific developmental stages

    • Assess rescue of phenotypic abnormalities

These approaches can reveal developmental stage-specific roles of NAA in neurogenesis, neurite outgrowth, and brain development .

What is the relationship between nat8l activity, NAA production, and neuroprotection?

Studies indicate complex relationships between nat8l, NAA, and neuroprotection:

  • Oxidative Stress Responses:

    • NAA levels decrease in response to oxidative stress in zebrafish embryos

    • Recombinant nat8l supplementation can be tested for protective effects against reactive oxygen species (ROS)

    • Experimental designs should include quantification of localized ROS production in the developing brain

  • Dopaminergic System Protection:

    • Human NAT8L promotes dopamine uptake by regulating TNF-alpha expression

    • It attenuates methamphetamine-induced inhibition of dopamine uptake

    • Zebrafish nat8l likely plays similar roles, which can be studied using neurotoxin exposure models

  • Metabolic Coupling:

    • NAA serves as a precursor for N-acetylaspartylglutamate (NAAG)

    • NAAG is synthesized by RIMKLA in the CNS from NAA and glutamate

    • This pathway's disruption affects neuronal energetics and neurotransmission

Researchers should design experiments that measure both nat8l activity and downstream metabolites to fully understand these neuroprotective mechanisms .

How do environmental toxins affect nat8l activity and NAA metabolism in zebrafish models?

Environmental toxicology studies have revealed:

  • β-methylamino-L-alanine (BMAA) Exposure:

    • Causes significant decreases in NAA levels in zebrafish embryos

    • Disrupts metabolic reprogramming during development

    • Affects NAA-dependent lipid biosynthetic pathways

  • Nanoplastics Exposure:

    • Polyethylene terephthalate nanoplastics (PET NPs) induce oxidative stress

    • Alter metabolites related to detoxification pathways

    • Impair mitochondrial membrane integrity and cellular bioenergetics

Experimental approaches should include:

  • Dose-response studies with various toxins

  • Time-course analyses of nat8l expression and activity

  • Correlative studies between NAA levels and phenotypic outcomes

These investigations provide insights into how environmental factors might contribute to neurodevelopmental disorders through disruption of NAA metabolism .

What are common challenges in obtaining enzymatically active recombinant nat8l?

Researchers frequently encounter several issues:

  • Protein Solubility Problems:

    • Nat8l can form inclusion bodies in E. coli expression systems

    • Solution: Lower induction temperature (16-18°C), reduce IPTG concentration, or use solubility-enhancing fusion tags

  • Low Enzymatic Activity:

    • Recombinant protein may fold incorrectly

    • Solution: Add molecular chaperones (GroEL/GroES) during expression, or switch to eukaryotic expression systems like wheat germ

  • Protein Degradation:

    • N-terminal regions may be susceptible to proteolysis

    • Solution: Include protease inhibitors during purification, optimize buffer conditions, or design truncated constructs that retain activity

  • Cofactor Requirements:

    • Ensure all necessary cofactors (ATP, Mg²⁺) are present in activity assays

    • Solution: Supplement reaction mixtures with fresh cofactors and optimize their concentrations .

How can researchers address data inconsistencies in NAA quantification experiments?

When faced with inconsistent NAA measurements:

  • Sample Preparation Variability:

    • Standardize tissue homogenization protocols

    • Ensure consistent extraction conditions for metabolites

    • Employ internal standards for quantitative analyses

  • Analytical Method Limitations:

    • NMR methods may have lower sensitivity than mass spectrometry

    • HPLC methods may suffer from co-eluting compounds

    • Solution: Validate results using multiple analytical platforms

  • Biological Variability:

    • NAA levels naturally vary during development

    • Circadian fluctuations may affect measurements

    • Solution: Increase sample sizes, carefully control for developmental stage and time of collection

  • Enzyme Stability During Analysis:

    • NAA-metabolizing enzymes may remain active during sample processing

    • Solution: Rapidly inactivate enzymes by heat treatment or acidification during sample collection .

What controls are essential when studying nat8l function in zebrafish embryos?

Rigorous experimental design requires several controls:

  • Enzymatic Assay Controls:

    • No-enzyme controls to account for non-enzymatic reactions

    • Heat-inactivated enzyme controls to confirm activity is protein-dependent

    • Substrate specificity controls using related compounds

  • Developmental Controls:

    • Precise staging of embryos using standardized criteria

    • Synchronization of developmental timelines

    • Morphological assessment to verify normal development

  • Technical Controls for In Vivo Studies:

    • Vehicle controls for compound treatments

    • Sham injections for microinjection studies

    • Randomization and blinding in phenotypic analyses

  • Genetic Controls:

    • Use of characterized nat8l mutant lines as negative controls

    • Rescue experiments with wild-type nat8l to confirm specificity

    • CRISPR/Cas9 controls to account for off-target effects

These controls ensure that observed effects are specifically attributable to nat8l function and not experimental artifacts .

What are promising approaches for studying nat8l function in neurodevelopmental disorders?

Emerging research strategies include:

  • Genome Editing Technologies:

    • Generate precise nat8l mutations mirroring human disease variants

    • Create conditional knockouts for temporal control of nat8l expression

    • Develop reporter lines to visualize nat8l expression patterns

  • Single-Cell Metabolomics:

    • Measure NAA levels in individual neurons during development

    • Correlate with electrophysiological properties

    • Identify cell-type specific requirements for NAA

  • Advanced Imaging Techniques:

    • Apply label-free Raman microscopy to visualize NAA distribution in vivo

    • Use correlative light-electron microscopy to link NAA metabolism with ultrastructural changes

    • Develop NAA-sensitive fluorescent reporters

These approaches will provide unprecedented resolution of nat8l function in neural development and pathology .

How might recombinant nat8l contribute to therapeutic development?

Potential therapeutic applications include:

  • Enzyme Replacement Strategies:

    • Optimize recombinant nat8l for stability in physiological conditions

    • Develop delivery methods targeting the CNS

    • Assess efficacy in models of NAA deficiency

  • Drug Discovery Platforms:

    • High-throughput screening assays using recombinant nat8l

    • Identification of small molecule modulators of enzyme activity

    • Structure-based design of specific nat8l activators

  • Combination Approaches:

    • Co-administration with NAAG peptidase inhibitors

    • Supplementation with NAA precursors

    • Complementary therapies targeting downstream metabolic pathways

These therapeutic directions may provide novel interventions for neurological disorders associated with NAA metabolism disruption .

How does zebrafish nat8l compare functionally to orthologous enzymes in other model organisms?

Comparative studies reveal important insights:

SpeciesProtein LengthKey Structural FeaturesOptimal Activity ConditionsNotable Functional Differences
Zebrafish (Danio rerio)282 aaN-terminal regulatory domain, conserved catalytic corepH 7.1-8.0, 25-30°CHigher temperature tolerance, developmental expression patterns differ from mammals
Human (Homo sapiens)302 aaExtended N-terminal domain, highly conserved catalytic sitepH 7.4, 37°CHigher substrate specificity for L-aspartate
Mouse (Mus musculus)298 aaSimilar to human, minor variations in regulatory domainspH 7.2-7.4, 37°CSimilar kinetics to human enzyme
Rat (Rattus norvegicus)301 aaClosely related to mouse and human orthologspH 7.2-7.4, 37°CMinor differences in regulatory properties

Researchers should account for these differences when extrapolating findings across species and design experiments to systematically compare enzymatic properties under standardized conditions .

What are the key differences between nat8l and related enzymes in the NAT family?

Understanding the functional relationships within the NAT family:

  • NAT8L vs. NAT8:

    • NAT8L specifically catalyzes NAA synthesis

    • NAT8 primarily acts on cysteine-S-conjugates

    • Both share core catalytic mechanisms but differ in substrate specificity

  • NAT8L vs. RIMKLA/RIMKLB:

    • NAT8L produces NAA from aspartate and acetyl-CoA

    • RIMKLA uses NAA to synthesize NAAG

    • RIMKLB can produce both NAAG and β-citrylglutamate

    • These enzymes form a metabolic network for neuronal signaling molecules

  • Structural Basis for Functional Differences:

    • Substrate binding pocket variations determine specificity

    • Different cofactor requirements (acetyl-CoA vs. ATP)

    • Regulatory domain differences affect activity modulation

Experimental approaches to study these relationships should include reciprocal substrate testing, domain swapping experiments, and structural analyses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.