Recombinant Danio rerio N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (gnptab)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Danio rerio N-acetylglucosamine-1-phosphotransferase subunits alpha/beta (GNPTAB) refers to the engineered production of the alpha and beta subunits of the enzyme N-acetylglucosamine-1-phosphotransferase (GlcNAc-1-phosphotransferase) in heterologous systems (e.g., E. coli, yeast). This enzyme is critical for tagging lysosomal hydrolases with mannose 6-phosphate (M6P), ensuring their proper trafficking to lysosomes .

Key Features:

PropertyDetails
Gene OriginGNPTAB (zebrafish, Danio rerio) encodes alpha/beta subunits .
Subunit CompositionAlpha (894–1219 amino acids) and beta subunits form a heterodimer .
Catalytic FunctionTransfers N-acetylglucosamine-1-phosphate (GlcNAc-1-P) to lysosomal enzymes .
Clinical RelevanceMutations in GNPTAB cause mucolipidosis II/III, lysosomal storage disorders .

Critical Domains:

  • DMAP Interaction Domain: Mediates recognition of lysosomal enzymes (e.g., cathepsin D, α-iduronidase) . Mutations (e.g., K732N) impair binding, reducing phosphorylation efficiency .

  • Stealth Domain: Proposed catalytic region homologous to bacterial polysaccharide synthases .

  • Notch Repeats: Structural motifs potentially involved in substrate interaction .

Production and Purity

Recombinant GNPTAB is typically expressed in E. coli or yeast systems with high purity:

ParameterValue
HostE. coli, yeast, or mammalian cells .
Purity>85% (SDS-PAGE) , >90% (His-tagged) .
TagN-terminal His-tag (Q5RGJ8) .
Storage-20°C/-80°C, lyophilized powder .

Enzyme Activity Assays:

  • Substrate Specificity: Phosphorylates lysosomal enzymes (e.g., β-galactosidase) but not nonlysosomal glycoproteins .

  • Kinetic Studies: Activity toward α-methyl d-mannoside (α-MM) serves as a control for catalytic function .

Disease Modeling:

  • Mucolipidosis II/III: Mutations in GNPTAB (e.g., K732N) disrupt acid hydrolase phosphorylation, mimicking human disease phenotypes in zebrafish models .

Clinical and Diagnostic Relevance

ApplicationDetails
Disease DiagnosisUsed in ELISA kits for detecting GNPTAB antibodies or protein levels .
Therapeutic ResearchStudies focus on rescuing phosphorylation defects in mucolipidosis models .
Biomarker DevelopmentAbnormal GNPTAB activity correlates with lysosomal dysfunction in diseases like stuttering .

Key Research Findings

  1. Substrate Recognition: The DMAP domain binds acid hydrolases via conformation-dependent interactions .

  2. Gamma Subunit Synergy: GNPTG enhances phosphorylation of high-mannose glycans, enabling M6P marker formation .

  3. Mucolipidosis Mechanism: GNPTAB mutations (e.g., S385L, E389K) disrupt UDP-GlcNAc binding or catalysis, leading to enzyme mislocalization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
gnptab; gnpta; si:ch211-234f20.3; zgc:122985; N-acetylglucosamine-1-phosphotransferase subunits alpha/beta; GlcNAc-1-phosphotransferase subunits alpha/beta; Stealth protein gnptab; UDP-N-acetylglucosamine-1-phosphotransferase subunits alpha/beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
894-1219
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
gnptab
Target Protein Sequence
DTFADSLRYVNRLLNAQFGFTSRKVPAHMPHMIDRLIMQELQDTFPQEFDKTSSHRVRHS EDMQFAFSYFYFLMSAVQQLNISEVFDEIDTDHSGVLSDREIRTLATRIHELPLSLQDLT SLEQMLINCSKSLPSNLTHLHAVSPTQEAYYDPSMPPVTKGLVIHCKPITERIHKAFKDQ NKYKFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFICLNDNIDHIHKDAGTVKAVL RDFYESMFPLPSQFELPREYRNRFLHMTELQEWRIYRDKLKFWTHCVLVTLVVFTVMSFF AEQLVMLKRWLFPRRRVSKDANPERV
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of mannose 6-phosphate (M6P) markers on high-mannose type oligosaccharides within the Golgi apparatus. These M6P residues are essential for binding to mannose 6-phosphate receptors (MPRs), which mediate the vesicular transport of lysosomal enzymes to the endosomal/prelysosomal compartment.

Gene References Into Functions
  1. The DMAP interaction domain of the alpha subunit plays a crucial role in the selective recognition of acid hydrolase substrates. This understanding helps explain the impaired phosphorylation of acid hydrolases observed in patients with mucolipidosis II. PMID: 23733939
Database Links

KEGG: dre:553365

STRING: 7955.ENSDARP00000040444

UniGene: Dr.7927

Protein Families
Stealth family
Subcellular Location
[N-acetylglucosamine-1-phosphotransferase subunit alpha]: Golgi apparatus membrane; Single-pass type I membrane protein.; [N-acetylglucosamine-1-phosphotransferase subunit beta]: Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the primary function of gnptab in zebrafish?

The gnptab gene in Danio rerio encodes the α and β subunits of N-acetylglucosamine-1-phosphotransferase (GlcNAc-1-phosphotransferase), an enzyme with the EC number 2.7.8.17. This enzyme catalyzes the initial step in the formation of the mannose 6-phosphate targeting signal on newly synthesized lysosomal acid hydrolases. The mannose 6-phosphate residues subsequently function as high-affinity ligands for binding to mannose 6-phosphate receptors in the trans-Golgi network, facilitating the proper sorting and delivery of acid hydrolases to lysosomes . The enzyme plays a crucial role in lysosomal biogenesis and function, as evidenced by the severe lysosomal storage disorders that arise from mutations in this gene. In zebrafish, as in humans, the protein exists as part of a heterohexameric complex with an α₂β₂γ₂ structure, where the α and β subunits are encoded by gnptab and the γ subunits by gnptg .

What domains are present in zebrafish gnptab and what are their functions?

The zebrafish gnptab protein contains several identifiable functional domains separated by spacer regions:

  • Stealth Domain: Consists of four regions distributed throughout the α and β subunits. This domain shares similarity to bacterial genes involved in cell wall polysaccharide synthesis and functions as a sugar-phosphate transferase. Research has demonstrated that the Stealth domain harbors the catalytic site of the enzyme, as mutations in this region significantly impair enzymatic activity without affecting Golgi localization or proteolytic processing .

  • Notch Repeats: The protein contains Notch repeat modules similar to those found in Notch receptor family members. Studies have shown that the Notch repeat 1 plays a role in lysosomal hydrolase recognition. Mutations in conserved cysteine residues in this domain do not affect catalytic activity but impair mannose phosphorylation of specific lysosomal hydrolases, indicating its role in substrate recognition .

  • DMAP Interaction Domain: Originally described as a component of DNA methyltransferase (DNMT1), this domain functions as a protein-substrate recognition module. Mutations in this domain, such as K732N, result in impaired binding and decreased phosphorylation of lysosomal acid hydrolases without affecting catalytic activity toward simple sugar substrates .

  • N-terminal Cytoplasmic Tail: The N-terminal region of the α subunit contains residues important for Golgi retention of the enzyme. Mutations in this region can lead to decreased retention of catalytically active enzyme in the Golgi complex .

What are the optimal storage conditions for recombinant gnptab protein and antibodies?

For recombinant Danio rerio gnptab protein:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Repeated freezing and thawing is not recommended

  • Working aliquots can be stored at 4°C for up to one week

For gnptab antibodies:

  • Upon receipt, store at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles

  • The antibodies are typically supplied in a storage buffer containing:

    • 50% Glycerol

    • 0.01M PBS, pH 7.4

    • 0.03% Proclin 300 as a preservative

These storage recommendations are critical for maintaining protein and antibody integrity. Improper storage can lead to protein degradation, loss of enzymatic activity, or reduced antibody binding capacity, compromising experimental results and reproducibility.

What methodologies are available for studying gnptab function in zebrafish models?

Several complementary approaches can be employed to investigate gnptab function in zebrafish:

  • Morpholino Knockdown: Specific morpholino oligonucleotides can be used to inhibit gnptab expression. Validated protocols typically use 8 ng of gnptab splice-blocking morpholino oligonucleotides for maximal specific inhibition .

  • mRNA Rescue Experiments: Following morpholino knockdown, 300 pg of wild-type or mutant gnptab mRNA can be injected to assess functional rescue. This approach allows for the investigation of specific mutations and their effects on protein function .

  • Enzymatic Activity Assays: Direct measurement of GlcNAc-1-phosphotransferase activity can be performed in zebrafish embryo lysates. Additionally, cathepsin K activity assays provide an indirect measure of proper lysosomal enzyme targeting .

  • Phenotypic Assessment:

    • Alcian blue staining for cartilage analysis

    • Morphometric analysis of craniofacial structures

    • Measurement of specific cartilage structures using imaging software

  • Cation-independent Mannose 6-Phosphate Receptor Affinity Chromatography: This technique can be used to determine the percentage of mannose phosphorylated β-galactosidase activity, providing insights into the efficiency of the mannose phosphorylation process .

How can site-directed mutagenesis be used to study gnptab domains?

Site-directed mutagenesis is a valuable approach for investigating the functional significance of specific amino acid residues within gnptab. The following protocol has been successfully employed to generate gnptab mutants:

  • Primer Design: Design complementary primers containing the desired mutation. Examples from published research include:

Amino acid changeForward primer (5′ → 3′)Reverse primer (5′ → 3′)
W81LGACGTTGTTTACACCTTGGTGAATGGCACAGATCTTGCAAGATCTGTGCCATTCACCAAGGTGTAAACAACGTC
V182DCCTTCTACCAATGTCTCAGATGTTGTTTTTGACAGTACGTACTGTCAAAAACAACATCTGAGACATTGGTAGAAGG
D190VGACAGTACTAAGGTTGTTGAAGATGCCCACTCGAGTGGGCATCTTCAACAACCTTAGTACTGTC
R334QCTGAGGTACTCATTGCAATCTATCGAGAGGCATGCGCATGCCTCTCGATAGATTGCAATGAGTACCTCAG
R334LCTGAGGTACTCATTGCTATCTATCGAGAGGCATGCGCATGCCTCTCGATAGATAGCAATGAGTACCTCAG
  • PCR-based Mutagenesis: Use QuikChange site-directed mutagenesis or similar methods to introduce mutations. For example, C447Y mutations can be generated using the primers:

    • 5′-CAA ATT GTG CTG AGG GCT ATC CAG GAT CCT GGA TCA AAG-3′

    • 5′-CTT TGA TCC AGG ATC CTG GAT AGC CCT CAG CAC AAT TTG-3′

  • Functional Characterization:

    • Express wild-type and mutant constructs in appropriate cell lines

    • Assess subcellular localization by immunofluorescence

    • Measure enzymatic activity toward both simple sugar substrates (α-methyl D-mannoside) and lysosomal enzyme substrates

    • Evaluate protein processing by Western blot analysis

    • Perform zebrafish rescue experiments to assess in vivo functionality

This approach has successfully identified critical residues in the Stealth domain involved in catalytic activity and residues in the Notch repeat domains involved in lysosomal hydrolase recognition.

How do zebrafish gnptab models contribute to understanding human mucolipidosis disorders?

Zebrafish gnptab models have emerged as valuable tools for studying human mucolipidosis disorders. Mutations in the human GNPTAB gene cause mucolipidosis II (ML II, also known as I-cell disease) and the attenuated form mucolipidosis III αβ (ML III αβ, also known as pseudo-Hurler polydystrophy) . These are lysosomal storage disorders characterized by the missorting of lysosomal enzymes.

Zebrafish gnptab models offer several advantages:

  • Genetic Conservation: The zebrafish gnptab gene (UniProt ID Q5RGJ8) shows considerable homology to its human counterpart, including conservation of key functional domains like the Stealth domain, Notch repeats, and DMAP interaction domain .

  • Phenotypic Relevance: Gnptab-deficient zebrafish display phenotypes that parallel aspects of human mucolipidosis, particularly craniofacial abnormalities that can be quantified using Alcian blue staining and morphometric analysis .

  • Versatility for Mutation Studies: The zebrafish model allows for rapid assessment of various patient mutations through mRNA rescue experiments in gnptab morphants .

  • Mechanistic Insights: Studies in zebrafish have revealed that different domains of gnptab serve distinct functions:

    • The Stealth domain harbors the catalytic site

    • The Notch repeat 1 is involved in lysosomal hydrolase recognition

    • The spacer region between Notch 2 and DMAP may play a role in γ subunit binding

These findings have provided valuable insights into the molecular mechanisms underlying mucolipidosis disorders and have helped clarify how different mutations lead to varying disease severities.

What is the relationship between gnptab and gnptg in the context of mucolipidosis research?

The relationship between gnptab and gnptg is critical for understanding the complete function of the GlcNAc-1-phosphotransferase complex and the spectrum of mucolipidosis disorders:

  • Subunit Composition: GlcNAc-1-phosphotransferase is an α₂β₂γ₂ heterohexamer where:

    • The α and β subunits are encoded by gnptab

    • The γ subunits are encoded by gnptg

  • Complementary Functions:

    • The α/β subunits contain the catalytic site within the Stealth domain

    • The γ subunit contains a mannose-6-phosphate receptor homology (MRH) domain that belongs to a family of mannose-binding lectins

    • This MRH domain in GNPTG shares up to 30% sequence identity with other mannose-binding proteins

  • Differential Disease Severity:

    • Mutations in GNPTAB cause the severe mucolipidosis II or the attenuated mucolipidosis III αβ

    • Mutations in GNPTG cause the least severe phenotype, mucolipidosis III γ

  • Functional Rescue: Research has shown that certain gnptab mutations, such as R587P located in the spacer between Notch 2 and DMAP, can be partially rescued by overexpression of the γ subunit. This suggests that this region plays a role in γ subunit binding and highlights the cooperative nature of these subunits .

  • Structural Insights: Crystal structure analysis has revealed that the GNPTG MRH domain can bind to N-linked glycans, with the binding site occupied by glycans from neighboring protein copies in crystal lattice arrangements .

Understanding this relationship has important implications for developing targeted therapeutic approaches for different forms of mucolipidosis.

What phenotypic assays are most informative when evaluating gnptab function in zebrafish models?

Several phenotypic assays have proven particularly informative for evaluating gnptab function in zebrafish models:

  • Cartilage Development Assessment:

    • Alcian blue staining to visualize and quantify craniofacial cartilage structures

    • Morphometric analysis using imaging software to measure specific cartilage structures

    • This approach is sensitive for detecting abnormalities associated with gnptab deficiency

  • Enzymatic Activity Measurements:

    • Direct GlcNAc-1-phosphotransferase activity assays to assess catalytic function

    • Normalized cathepsin K activity measurements as an indicator of proper lysosomal enzyme targeting

    • These assays provide quantitative data on enzyme function and can detect partial functional impairments

  • Mannose Phosphorylation Efficiency:

    • Cation-independent mannose 6-phosphate receptor affinity chromatography

    • Determination of the percentage of mannose phosphorylated β-galactosidase activity

    • This approach specifically assesses the efficiency of the mannose phosphorylation process

  • mRNA Rescue Experiments:

    • Injection of wild-type or mutant gnptab mRNA into gnptab-deficient embryos

    • Assessment of phenotypic rescue using the above methods

    • This approach allows for the evaluation of specific mutations and their functional consequences

These complementary assays provide a comprehensive assessment of gnptab function and can detect subtle differences between various mutations, correlating with disease severity in human patients.

How do specific missense mutations in different gnptab domains affect protein function?

Comprehensive analysis of missense mutations in gnptab has revealed domain-specific effects on protein function:

  • N-terminal Region Mutations (e.g., K4Q, S15Y):

    • Decreased retention of catalytically active enzyme in the Golgi complex

    • Normal catalytic activity and hydrolase recognition

    • These findings indicate a role for these residues in trafficking and Golgi retention of the enzyme

  • Stealth Domain Mutations:

    • Greatly impaired enzymatic activity without affecting Golgi localization or proteolytic processing

    • These findings confirm that the Stealth domain harbors the catalytic site of the enzyme

  • Notch Repeat 1 Mutations (e.g., C447Y, C473S in conserved cysteine residues):

    • Normal catalytic activity toward simple sugar substrates

    • Impaired mannose phosphorylation of specific lysosomal hydrolases

    • Rescue experiments in zebrafish showed selective effects on hydrolase recognition that differ from DMAP mutations

    • These findings demonstrate a role for Notch repeat 1 in lysosomal hydrolase recognition

  • DMAP Domain Mutations (e.g., K732N):

    • Impaired binding and decreased phosphorylation of lysosomal acid hydrolases

    • Normal catalytic activity toward simple sugar substrates like α-methyl D-mannoside

    • These findings implicate the DMAP domain as a protein substrate recognition module

  • Spacer Region Mutations (e.g., R587P, located between Notch 2 and DMAP):

    • Partially rescued by overexpression of the γ subunit

    • This suggests a role for this region in γ subunit binding

This domain-specific understanding of mutation effects provides valuable insights for predicting the functional consequences of novel mutations and for developing potential therapeutic strategies.

What methodological approaches are used to express and purify recombinant zebrafish gnptab for structural studies?

For structural studies of zebrafish gnptab, researchers have developed specific methodological approaches for expression and purification:

  • Construct Design:

    • For expression of zebrafish GNPTAB (UniProt ID Q5RGJ8), a minimal construct comprising:

    • Melittin signal peptide for secretion

    • Hexahistidine tag (DRHHHHHHGS) for purification

    • The relevant protein domains

  • Expression Systems:

    • Mammalian expression systems (typically HEK293 cells) are preferred for proper folding and post-translational modifications

    • Insect cell expression systems may be used as alternatives

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using the hexahistidine tag

    • Size exclusion chromatography to obtain homogeneous protein preparations

    • Ion exchange chromatography for further purification if needed

  • Quality Control:

    • SDS-PAGE to assess purity

    • Western blotting to confirm identity

    • Activity assays to verify functional integrity

    • Dynamic light scattering to assess homogeneity

  • Structural Analysis Techniques:

    • X-ray crystallography for high-resolution structure determination

    • Cryo-electron microscopy for complex assemblies

    • Small-angle X-ray scattering for solution structure

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and interactions

These methodological approaches have enabled researchers to gain insights into the structural basis of gnptab function, including the identification of mannose-binding sites and the arrangement of functional domains .

How can zebrafish gnptab models inform therapeutic development for mucolipidosis disorders?

Zebrafish gnptab models provide valuable platforms for therapeutic development strategies for mucolipidosis disorders:

  • Mutation-Specific Therapies:

    • Domain-specific understanding of mutations allows for targeted therapeutic approaches

    • For mutations affecting trafficking (N-terminal region), therapies focusing on enhancing Golgi retention could be beneficial

    • For catalytic domain mutations (Stealth domain), enzyme replacement therapies might be more appropriate

    • For mutations affecting substrate recognition (Notch or DMAP domains), therapies enhancing binding affinity could be developed

  • Gene Therapy Optimization:

    • Zebrafish models allow for rapid testing of gene therapy constructs

    • mRNA rescue experiments in gnptab-deficient zebrafish provide proof-of-concept for gene replacement approaches

    • Optimal dosing and delivery methods can be initially assessed in zebrafish before moving to mammalian models

  • Drug Screening Platforms:

    • The well-characterized phenotypes in gnptab-deficient zebrafish (cartilage abnormalities, enzyme activity deficits) provide quantifiable endpoints for drug screening

    • High-throughput screening of chemical libraries can identify compounds that ameliorate phenotypes

    • Zebrafish models are particularly suitable for initial drug screening due to their small size, transparency, and rapid development

  • Chaperone Therapy Development:

    • For missense mutations that affect protein folding, pharmacological chaperones could be developed to stabilize the mutant protein

    • Zebrafish models expressing specific patient mutations can be used to test the efficacy of candidate chaperone molecules

  • γ Subunit Modulation:

    • The observation that overexpression of the γ subunit can partially rescue certain gnptab mutations (e.g., R587P) suggests a potential therapeutic approach involving γ subunit modulation

    • Compounds that enhance γ subunit binding or stability could be beneficial for specific mutations

These approaches highlight how the mechanistic insights gained from zebrafish models can be translated into targeted therapeutic strategies for mucolipidosis disorders, potentially leading to personalized medicine approaches based on a patient's specific mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.