Recombinant Danio rerio N-acetyltransferase 14 (nat14)

Shipped with Ice Packs
In Stock

Description

Overview of NAT14

N-acetyltransferases (NATs) are a family of enzymes that catalyze the transfer of an acetyl group from acetyl-CoA to an arylamine or other substrate . In Danio rerio (zebrafish), N-acetyltransferase 14 (Nat14) is a protein-coding gene also known as zgc:153234 . The protein encoded by the nat14 gene is a probable N-acetyltransferase 14, with the enzyme commission number EC=2.3.1.- .

Gene Information

The human NAT14 gene, also known under the aliases NAT14; N-acetyltransferase 14 (GCN5-related, putative); N acetyltransferase 14; K562 cells derived leucine zipper like protein 1; KLP1; K562 cell-derived leucine-zipper-like protein 1, is located on Homo sapiens . The official symbol for the human gene is NAT14, with a gene ID of 57106, mRNA RefSeq NM_020378, and Protein RefSeq NP_065111 .

Protein Information

Zebrafish Nat14 is a full-length protein consisting of 280 amino acids . Human NAT14 (N-Acetyltransferase 14 (Putative)) is a protein coding gene . GO annotations related to this gene include N-acetyltransferase activity .

The table below lists key features of Recombinant Human NAT14 Protein:

FeatureDescription
SpeciesHuman
SourceWheat Germ
TagGST
Molecular Mass48.1 kDa
Amino Acid SequenceMAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLASFALALLLPVFLAVAAVKLGLRARWGSLPPPGGLGGPWVAVRGSGDVCGVLALAPGTNAGDGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGMGEPRARLVVPVAVAAWGVGGMLEGCGYQAEGGWGCLGYTLVREFSKDL
ApplicationsEnzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array

Function and Significance

NAT14 belongs to the N-acetyltransferase family of enzymes. N-terminal acetylation is a prevalent protein modification with impacts on protein stability . Studies in yeast have shown that N-terminal acetylation can promote protein stability . Additionally, a study on zebrafish found that one functional allele of naa80 is sufficient for complete actin Nt-acetylation .

Recombinant NAT14

Recombinant Danio rerio NAT14 is produced in vitro using an E. coli expression system . It is available as a recombinant protein for research purposes, such as ELISA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please specify it for preferential development.
Synonyms
nat14; zgc:153234; Probable N-acetyltransferase 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MVRLDLADVVLRRMQEKDIEAVKALIKEGCEGTENRLILHLLTRPLALLLLAILSSILRC VLHSFVLALVIPVFISVIYLKLTIPRSAGILGSCRPYWDYIGSSYHADTEPDLPNPHLGR AKLTTNQEKTRRRKKAKEKEKMNESEQVDEDELKQRAKVAGEVWVADSDGEIVGCVARDG WSRDGVCRVCRLVVQCWYRREGLGRLLVQGLESRTKQKGVCRVYAHVPIPSKVGEAFFRR LGYRLQGETAGIEEEEEDDYEDPEKGWLGYPLTKVFVKDL
Uniprot No.

Target Background

Function

Probable acetyltransferase.

Database Links
Protein Families
Camello family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is Recombinant Danio rerio N-acetyltransferase 14 typically produced for research applications?

Recombinant Danio rerio N-acetyltransferase 14 (nat14) is typically produced using cell-free expression systems to ensure high purity and functionality . The production process involves:

  • Gene synthesis or cloning: The nat14 gene sequence (encompassing regions 1-280) is optimized for expression in the selected system.

  • Expression system preparation: Cell-free expression systems are utilized to produce the recombinant protein without cellular contamination .

  • Protein purification: Following expression, the protein undergoes multistep purification processes to achieve purity levels of ≥85% as determined by SDS-PAGE .

  • Quality control: The recombinant protein is verified through various analytical methods including SDS-PAGE, Western blotting, and activity assays to confirm identity, purity, and functionality.

  • Stabilization and storage: The purified protein is typically formulated in a Tris-based buffer containing 50% glycerol optimized for protein stability . For long-term preservation, storage at -20°C or -80°C is recommended, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What are the primary research applications for Recombinant Danio rerio N-acetyltransferase 14?

Recombinant Danio rerio N-acetyltransferase 14 (nat14) serves multiple research purposes:

  • Enzymatic activity studies: As an N-acetyltransferase (EC 2.3.1.-), nat14 is useful for investigating acetylation mechanisms in zebrafish models .

  • Antibody production and validation: The purified recombinant protein can serve as an antigen for developing antibodies against nat14 for immunological studies.

  • Protein-protein interaction studies: The recombinant protein enables investigations of binding partners and molecular pathways involving nat14.

  • Structural biology: The availability of full-length recombinant protein (regions 1-280) facilitates crystallography and other structural studies .

  • Comparative studies: While research on zebrafish nat14 is emerging, comparative studies with human N-acetyltransferases such as NAT1 can provide valuable insights into evolutionary conservation and functional divergence of these enzymes .

How can Recombinant Danio rerio N-acetyltransferase 14 be used in ELISA-based experimental designs?

ELISA-based experiments using Recombinant Danio rerio N-acetyltransferase 14 (nat14) require careful optimization:

  • Plate coating: When using nat14 as a capture antigen, optimal coating concentration typically ranges from 1-5 μg/mL in carbonate/bicarbonate buffer (pH 9.6), with overnight incubation at 4°C.

  • Blocking optimization: A 2-5% BSA or non-fat milk solution in PBS-T (PBS with 0.05% Tween-20) for 1-2 hours at room temperature helps reduce non-specific binding.

  • Antibody dilution series: For detecting nat14-specific antibodies, prepare serial dilutions of test sera or antibodies to establish optimal detection ranges.

  • Detection systems: HRP or AP-conjugated secondary antibodies are typically used at 1:5000-1:10000 dilutions, with appropriate substrates (TMB for HRP; pNPP for AP).

  • Controls: Essential controls include:

    • Positive control: Known nat14-binding antibodies

    • Negative control: Non-specific antibodies

    • Background control: Wells without nat14 coating

    • Reagent controls: Secondary antibody only

  • Data analysis: Calculate standard curves and determine antibody titers or protein concentrations based on OD readings within the linear range of detection.

When developing an ELISA for detecting nat14, researchers should note that the protein's stability in Tris-based buffer with 50% glycerol may affect coating efficiency, potentially requiring buffer optimization through dialysis or dilution to reduce glycerol concentration prior to plate coating.

How is nat14 gene expression regulated in zebrafish development?

While specific information on nat14 regulation in zebrafish is limited in the provided search results, we can draw comparisons with related acetyltransferases and gene expression studies:

  • Developmental expression patterns: Similar to other zebrafish genes such as ints14, nat14 likely exhibits specific temporal and spatial expression patterns during embryonic development .

  • Regulatory mechanisms: N-acetyltransferases are often regulated through:

    • Transcriptional regulation via promoter elements

    • Post-transcriptional mechanisms such as RNA stability

    • Post-translational modifications affecting protein activity or localization

  • Stress response: Based on studies of related genes like serine O-acetyltransferase, nat14 expression might be modulated in response to environmental stressors. For instance, ApSAT (from Artrospira platensis) showed significant upregulation in response to H₂O₂-induced oxidative stress .

  • Tissue-specific expression: Analysis of nat14 expression across different zebrafish tissues would provide insight into tissue-specific functions, similar to how human NAT1 exhibits varied expression profiles across tissues .

To definitively characterize nat14 expression patterns, researchers should consider conducting:

  • qRT-PCR analysis across developmental stages

  • In situ hybridization to visualize spatial expression

  • Reporter gene constructs using the nat14 promoter

  • RNA-seq analysis to identify co-expressed genes

What approaches can be used to study nat14 function through gene knockout or knockdown in zebrafish?

Based on methodologies applied to related genes in zebrafish, several approaches can be employed to study nat14 function:

  • CRISPR/Cas9-mediated knockout: Similar to the approach used for ints14 , researchers can generate nat14 knockout zebrafish by:

    • Designing specific sgRNAs targeting conserved regions of the nat14 gene

    • Co-injecting Cas9 protein and sgRNA into fertilized zebrafish eggs

    • Screening for mutations using PCR analysis, T7E1 assays, and sequencing

    • Establishing stable mutant lines through breeding

  • Morpholino-based knockdown: Transient knockdown can be achieved using:

    • Translation-blocking morpholinos targeting the nat14 start codon region

    • Splice-blocking morpholinos targeting exon-intron junctions

    • Careful dose optimization to minimize off-target effects

    • Co-injection with p53 morpholino to control for non-specific toxicity

  • Small molecule inhibitors: If available, specific inhibitors of N-acetyltransferase activity can provide temporal control over protein function.

  • Rescue experiments: To validate phenotype specificity, researchers should:

    • Co-inject nat14 mRNA with morpholinos

    • Generate transgenic rescue lines in knockout backgrounds

    • Utilize domain-specific mutants to identify critical functional regions

  • Phenotypic analysis: Comprehensive phenotyping should include:

    • Morphological assessment at multiple developmental stages

    • Behavioral analysis

    • Histological examination of relevant tissues

    • Molecular analysis of potentially affected pathways

The ints14 knockout methodology described in the search results provides a valuable template, as it successfully generated mutant strains with 6- or 9-bp deletions in the target gene.

How does zebrafish nat14 compare structurally and functionally to human N-acetyltransferases?

Comparative analysis between zebrafish nat14 and human N-acetyltransferases reveals several important considerations:

  • Sequence homology: While specific alignment data is not provided in the search results, comparing the zebrafish nat14 amino acid sequence (Q0P4A4) with human N-acetyltransferases such as NAT1 would reveal conserved domains and potential functional similarities.

  • Structural domains: Both zebrafish nat14 and human NAT1 contain:

    • Acetyltransferase domains with catalytic residues

    • Substrate binding regions

    • Potential regulatory motifs

  • Functional divergence: Human NAT1 is well-characterized for its role in xenobiotic metabolism, particularly in the acetylation of arylamines . The specific substrates and physiological roles of zebrafish nat14 require further investigation but may differ based on evolutionary divergence.

  • Polymorphic variation: Human NAT1 exhibits genetic polymorphisms affecting enzyme activity, leading to phenotypes such as the "slow acetylator" phenotype . Research into zebrafish nat14 genetic variation could reveal similar functional polymorphisms.

  • Expression patterns: Human NAT1 shows tissue-specific expression patterns that influence xenobiotic metabolism . Characterizing zebrafish nat14 expression across tissues would provide insight into its physiological significance.

Researchers interested in comparative studies should consider:

  • Conducting in vitro substrate specificity assays

  • Developing zebrafish models expressing human NAT variants

  • Investigating conserved regulatory mechanisms

  • Performing functional complementation studies

What are the most effective methods for studying protein-protein interactions involving nat14?

Several complementary approaches can be employed to investigate protein-protein interactions involving Recombinant Danio rerio N-acetyltransferase 14:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-nat14 antibodies or epitope-tagged recombinant nat14

    • Validate interactions with reciprocal Co-IP experiments

    • Analyze precipitated complexes by mass spectrometry to identify unknown partners

  • Yeast two-hybrid (Y2H) screening:

    • Generate nat14 bait constructs (consider using full-length and domain-specific constructs)

    • Screen against zebrafish cDNA libraries

    • Validate interactions using orthogonal methods to eliminate false positives

  • Proximity labeling approaches:

    • Develop BioID or APEX2 fusion constructs with nat14

    • Express in relevant zebrafish cell lines or tissues

    • Identify proximal proteins through biotin labeling and mass spectrometry

  • Surface plasmon resonance (SPR):

    • Immobilize purified recombinant nat14 on sensor chips

    • Measure direct binding kinetics with potential interacting partners

    • Determine association/dissociation constants for validated interactions

  • Fluorescence-based interaction assays:

    • FRET (Förster Resonance Energy Transfer) using fluorophore-tagged proteins

    • BiFC (Bimolecular Fluorescence Complementation) for visualizing interactions in cells

    • F2H (Fluorescent Two-Hybrid) assay for real-time interaction monitoring

  • In silico analysis:

    • Protein docking simulations using the nat14 amino acid sequence

    • Prediction of interaction interfaces based on evolutionary conservation

    • Network analysis to predict functional partners

When working with transmembrane or membrane-associated proteins, specialized approaches such as split-ubiquitin systems or membrane yeast two-hybrid might be necessary, particularly given that nat14 contains hydrophobic regions that may be membrane-associated .

What are the established assays for measuring nat14 enzymatic activity?

Enzymatic activity assays for zebrafish nat14 can be adapted from established N-acetyltransferase protocols:

  • Spectrophotometric assays:

    • DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) coupled assay to detect free CoA production

    • pNPA (p-nitrophenyl acetate) hydrolysis assay measuring absorbance at 405 nm

    • Optimization of buffer conditions (pH 7.5-8.5), temperature (25-30°C), and substrate concentrations is essential

  • HPLC-based methods:

    • Separate and quantify acetylated products

    • Monitor depletion of acetyl-CoA substrate

    • Develop specific chromatography parameters for zebrafish nat14 substrates

  • Radiometric assays:

    • Utilize [¹⁴C] or [³H]-labeled acetyl-CoA

    • Measure transfer of radioactive acetyl groups to substrates

    • Extract and quantify labeled products by scintillation counting

  • Fluorescence-based assays:

    • Use fluorogenic substrates that change properties upon acetylation

    • Enable high-throughput screening applications

    • Allow real-time monitoring of enzymatic activity

For optimal results, consider the following parameters:

  • Buffer composition: typically Tris or phosphate buffers (50-100 mM)

  • pH range: 7.0-8.5 (specific optimum to be determined empirically)

  • Temperature: 25-37°C (zebrafish proteins often show optimal activity at lower temperatures than mammalian counterparts)

  • Divalent cation requirements (Mg²⁺, Mn²⁺, or Ca²⁺)

  • Reducing agents (DTT or β-mercaptoethanol) to maintain enzyme activity

Given that nat14 is stored in a Tris-based buffer with 50% glycerol , activity assays should account for buffer components and potential inhibitory effects of glycerol at high concentrations.

How can researchers identify and validate specific inhibitors of nat14 activity?

A systematic approach to identifying and validating nat14 inhibitors includes:

  • Initial screening approaches:

    • High-throughput screening of chemical libraries using optimized activity assays

    • In silico screening based on structural predictions or homology models

    • Fragment-based screening to identify chemical scaffolds with inhibitory potential

    • Repurposing screens of known N-acetyltransferase inhibitors

  • Inhibition mechanism characterization:

    • Enzyme kinetics to determine inhibition mode (competitive, non-competitive, uncompetitive)

    • IC₅₀ determination under standardized conditions

    • Ki value calculation for promising compounds

    • Structure-activity relationship (SAR) studies for lead optimization

  • Specificity assessment:

    • Counter-screening against related N-acetyltransferases

    • Profiling against a panel of other acetyltransferases

    • Assessment of off-target effects in cellular systems

  • Cellular validation:

    • Cell permeability assessment

    • Target engagement studies (cellular thermal shift assays, etc.)

    • Phenotypic assays in zebrafish cells expressing nat14

  • In vivo validation:

    • Pharmacokinetic studies in zebrafish

    • Dose-response assessment

    • Comparison of inhibitor-induced phenotypes with genetic knockdown/knockout models

    • Molecular phenotyping (transcriptomics, proteomics) to confirm mechanism

When developing inhibitors, researchers should consider structural features of nat14, including its full amino acid sequence , to identify potential binding sites. The experience with related acetyltransferases, such as studies on serine O-acetyltransferase from cyanobacteria , may provide valuable insights into potential inhibitory mechanisms.

How can nat14 research contribute to understanding human disease mechanisms?

Research on zebrafish nat14 can provide valuable insights into human disease mechanisms through several approaches:

  • Comparative genomics and evolution:

    • Identifying human orthologs of zebrafish nat14

    • Analyzing conservation of functional domains across species

    • Understanding evolutionary divergence of N-acetyltransferase functions

  • Metabolic pathway conservation:

    • Investigating whether nat14 participates in conserved metabolic pathways relevant to human disease

    • Comparing with human N-acetyltransferases like NAT1, which is implicated in cancer and other diseases

    • Identifying potential disease-relevant substrates

  • Disease modeling in zebrafish:

    • Generating nat14 mutants using CRISPR/Cas9 (similar to the approach used for ints14 )

    • Characterizing phenotypes relevant to human conditions

    • Testing potential therapeutic approaches

  • Cancer research applications:

    • Human NAT1 has been implicated in cancers including breast cancer and renal cell carcinoma

    • Studying zebrafish nat14 could provide models for investigating N-acetyltransferase roles in tumor development

    • Testing whether nat14 modification affects cancer hallmarks in zebrafish models

  • Xenobiotic metabolism:

    • Human N-acetyltransferases play critical roles in metabolizing environmental contaminants

    • Investigating whether zebrafish nat14 serves similar detoxification functions

    • Development of ecotoxicological models using nat14 activity as a biomarker

The methodology for creating genetic models using CRISPR/Cas9, as demonstrated with ints14 knockout zebrafish , provides a valuable template for generating nat14 mutants to study disease mechanisms.

What are the considerations for developing zebrafish nat14 mutant lines as disease models?

Developing zebrafish nat14 mutant lines requires careful experimental design:

  • CRISPR/Cas9 targeting strategy:

    • Design multiple sgRNAs targeting conserved functional domains

    • Aim for complete loss-of-function mutations (frameshifts or large deletions)

    • Consider generating domain-specific mutations for structure-function studies

    • Adapt protocols successfully used for ints14 knockout generation

  • Mutation validation:

    • PCR analysis and sequencing to confirm genetic modifications

    • T7E1 mismatch cleavage assay to detect heterozygous mutations

    • RT-PCR and western blotting to confirm effects on mRNA and protein expression

    • Enzymatic activity assays to verify functional consequences

  • Establishing stable lines:

    • Screen F₀ founders for germline transmission

    • Generate and characterize F₁ heterozygous carriers

    • Establish homozygous lines if viable

    • Create conditional knockout models if homozygous lethality is observed

  • Phenotypic characterization should be comprehensive:

    • Embryonic development assessment

    • Morphological analysis at multiple stages

    • Histological examination of relevant tissues

    • Behavioral testing

    • Metabolic profiling

    • Response to environmental challenges

    • Molecular phenotyping (transcriptomics, proteomics, metabolomics)

  • Addressing potential confounding factors:

    • Genetic background effects

    • Off-target mutations

    • Compensatory mechanisms (genetic compensation response)

    • Environmental variables affecting phenotype expressivity

  • Validating disease relevance:

    • Comparison with human patient data

    • Testing of disease-modifying factors

    • Response to relevant therapeutic interventions

The successful generation of ints14 knockout zebrafish described in the search results demonstrates that CRISPR/Cas9 can effectively create defined mutations in zebrafish genes, providing a methodological framework adaptable to nat14 studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.