Recombinant Danio rerio NADH-ubiquinone oxidoreductase chain 3 (mt-nd3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the product for multiple use to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
For specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-nd3; mtnd3; nd3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MNLFATILIIMTTLSLVLALVSFWLPQMNSDTEKLSPYECGFDPLGSARLPFSLRFFLVA VLFPLFDLEIALLLPLPWGDQLNNPMETLFWAMTVLILLTLGLAYEWAQGGLEWAE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is essential for the catalytic activity of complex I.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of mt-nd3 in zebrafish mitochondria?

Mt-nd3 encodes NADH-ubiquinone oxidoreductase chain 3, a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). In zebrafish, as in humans, this protein is essential for the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor. The protein is critical for energy production through oxidative phosphorylation, making it vital for normal cellular function, particularly in high-energy-demanding tissues such as the nervous system .

What experimental models are available for studying mt-nd3 in zebrafish?

Several experimental approaches can be utilized to study mt-nd3 in zebrafish:

  • Morpholino (MO)-mediated knockdown - Allows transient silencing of gene expression

  • CRISPR-Cas9 genome editing - Enables creation of stable mutant lines

  • Transgenic overexpression models - Permits analysis of gain-of-function phenotypes

  • qRT-PCR analysis - Facilitates quantitative assessment of mt-nd3 expression patterns during development

The choice of model depends on research objectives, with MO knockdown being suitable for preliminary studies and mutant lines essential for long-term phenotypic analysis.

How does mt-nd3 expression change during zebrafish development?

Mt-nd3 expression can be tracked throughout zebrafish developmental stages using quantitative real-time RT-PCR (qRT-PCR). Research indicates that mitochondrial genes, including mt-nd3, show dynamic expression patterns during development, reflecting the changing energy demands of developing tissues. The SYBR Premix Ex Taq TMII kit has been successfully used for qRT-PCR analysis of mt-nd genes, with β-actin serving as a reference gene for normalization . Developmental expression analysis reveals critical windows when mitochondrial function may be particularly vulnerable to genetic or environmental perturbations.

What antibodies and reagents are available for mt-nd3 research in zebrafish?

CodeProduct NameSpecies ReactivityApplication
CSB-PA864985XA01DILmt-nd3 AntibodyDanio rerio (Zebrafish)ELISA, WB (ensure identification of antigen)

Additional resources include recombinant proteins (though not specifically for zebrafish in the provided search results) and PCR primers designed for mt-nd3 expression analysis. When selecting antibodies, researchers should verify specificity through appropriate controls and consider cross-reactivity with related proteins .

How can I design a CRISPR-Cas9 strategy to generate zebrafish mt-nd3 mutants?

When designing a CRISPR-Cas9 strategy for mt-nd3 mutants, consider these methodological steps:

  • gRNA design: Target conserved functional domains of mt-nd3 using tools that minimize off-target effects

  • Delivery method: Microinjection of Cas9 protein with synthesized gRNA into one-cell stage embryos

  • Mutation screening: Using heteroduplex mobility assays and sequencing

  • Founder identification: Raising F0 fish and outcrossing to identify germline transmission

  • Homozygote generation: Incrossing heterozygous F1 carriers

Since mt-nd3 is mitochondrially encoded, special considerations for mitochondrial DNA editing are necessary. Researchers should analyze potential compensatory mechanisms through comprehensive transcriptomic analysis, as mitochondrial genome modifications may trigger nuclear genome responses .

What phenotypic analyses are most informative when studying mt-nd3 dysfunction in zebrafish?

A comprehensive phenotypic analysis of mt-nd3 dysfunction should include:

  • Bioenergetic assessment: Measuring oxygen consumption rate, ATP production, and mitochondrial membrane potential

  • Behavioral analysis: Examining swimming performance, startle response, and touch-evoked escape response

  • Neurological evaluation: Assessing motor neuron axon development, branching patterns, and neuromuscular junction integrity

  • Histological examination: Analyzing tissue-specific mitochondrial morphology and distribution

  • Molecular phenotyping: Measuring reactive oxygen species (ROS) levels and markers of mitochondrial stress

Previous studies of Complex I deficiencies in zebrafish have demonstrated phenotypes including developmental delays, reduced swimming capacity, cardiac abnormalities, and neurological defects. These manifestations parallel aspects of human mitochondrial disorders .

How do environmental toxicants affect mt-nd3 expression and function in zebrafish?

Environmental toxicants can significantly impact mt-nd3 expression and function through several mechanisms:

  • Direct inhibition: Compounds like rotenone specifically target Complex I

  • Oxidative damage: Toxicants inducing ROS production can damage mt-nd3 and other mitochondrial components

  • Transcriptional dysregulation: Some compounds alter expression levels of mitochondrial genes

  • Mitochondrial dynamics disruption: Toxicants may affect mitochondrial fission/fusion and quality control

Experimental approaches to study these effects include:

  • Exposure studies with concentration-response analysis

  • Time-course evaluation of gene expression changes

  • Assessment of mitochondrial function following exposure

  • Rescue experiments with antioxidants or specific pathway inhibitors

For example, research has shown that bisphenol A exposure can downregulate mitochondrial respiratory genes in zebrafish, while protective compounds like tea polyphenols may counteract these effects .

What are the most effective methods for measuring Complex I activity in zebrafish tissues expressing recombinant mt-nd3?

Measuring Complex I activity in zebrafish tissues expressing recombinant mt-nd3 requires specialized techniques:

  • Enzymatic assays: Spectrophotometric measurement of NADH oxidation rate in isolated mitochondria

  • High-resolution respirometry: Direct measurement of oxygen consumption in tissue samples or isolated mitochondria

  • In-gel activity assays: Blue native polyacrylamide gel electrophoresis followed by activity staining

  • Seahorse XF analysis: Measurement of oxygen consumption rate in live cells or tissue preparations

For accurate results, researchers should:

  • Optimize tissue homogenization protocols to preserve enzymatic activity

  • Include appropriate controls (positive, negative, and inhibitor-treated)

  • Normalize measurements to mitochondrial content markers

  • Consider developmental stage-specific reference values

These methods allow quantitative assessment of how recombinant mt-nd3 variants affect Complex I function .

How can zebrafish mt-nd3 models contribute to understanding human mitochondrial diseases?

Zebrafish mt-nd3 models offer unique advantages for understanding human mitochondrial diseases:

  • Genetic conservation: Mitochondrial respiratory chain components are highly conserved between zebrafish and humans

  • Optical transparency: Allows real-time visualization of mitochondrial dynamics in living embryos

  • High fecundity: Enables large-scale genetic and drug screens

  • Developmental accessibility: Facilitates study of disease progression from embryonic stages

These models have contributed to understanding diseases like Leigh syndrome, MELAS, and other disorders associated with Complex I deficiency. The pathological consequences of mitochondrial energy output deficiencies on the nervous system can be directly observed and quantified in zebrafish, providing insights that might be difficult to obtain in mammalian models .

What strategies can rescue mt-nd3 dysfunction phenotypes in zebrafish models?

Several rescue strategies have shown promise in zebrafish models of mitochondrial dysfunction:

  • Pharmacological approaches:

    • Compounds that enhance mitochondrial biogenesis (e.g., AICAR, resveratrol)

    • Antioxidants that reduce oxidative stress (e.g., N-acetylcysteine, MitoQ)

    • Metabolic modifiers that bypass respiratory chain defects (e.g., ketogenic compounds)

  • Genetic approaches:

    • Overexpression of compensatory genes

    • RNA-based therapeutics to modulate expression of complementary pathways

    • Gene therapy to replace or supplement dysfunctional genes

  • Nutritional interventions:

    • Supplementation with specific vitamins or cofactors

    • Modified diets that alter metabolic substrate utilization

Tea polyphenols, for example, have demonstrated protective effects against mitochondrial dysfunction in zebrafish, suggesting potential therapeutic applications . These rescue strategies provide not only mechanistic insights but also potential therapeutic avenues for human mitochondrial disorders.

How do mutations in mt-nd3 affect neural development and function in zebrafish?

Mutations in mt-nd3 can profoundly impact neural development and function through several mechanisms:

  • Energy deficiency: Neurons have high energy demands, making them vulnerable to Complex I dysfunction

  • Altered calcium homeostasis: Mitochondrial dysfunction affects neuronal calcium signaling

  • Increased oxidative stress: ROS production may damage neural tissues

  • Impaired axonal transport: Energy deficiency disrupts transport of mitochondria and other cargo

In zebrafish models, these effects manifest as:

  • Delayed or aberrant axonal outgrowth

  • Reduced synaptic density at neuromuscular junctions

  • Altered neuronal excitability

  • Behavioral abnormalities, including swimming defects and seizure-like activity

Zebrafish with Complex I deficiencies demonstrate phenotypes reminiscent of human neurological conditions, including motor neuron disorders and neurodevelopmental abnormalities .

What are the optimal protocols for isolating functional mitochondria from zebrafish tissues for mt-nd3 studies?

Isolating functional mitochondria from zebrafish tissues requires careful attention to methodology:

  • Tissue preparation:

    • Rapid dissection in ice-cold isolation buffer

    • Gentle homogenization to preserve mitochondrial integrity

    • Differential centrifugation to separate mitochondrial fraction

  • Buffer composition:

    • Sucrose or mannitol-based buffers to maintain osmotic balance

    • EGTA to chelate calcium

    • Protease inhibitors to prevent protein degradation

    • pH buffering to physiological levels (pH 7.2-7.4)

  • Quality assessment:

    • Respiratory control ratio measurement

    • Membrane potential assessment with fluorescent dyes

    • Western blotting for mitochondrial markers

  • Considerations for different tissues:

    • Muscle: Higher mechanical disruption needed

    • Brain: Gentler homogenization required

    • Embryos: Enzymatic digestion may be necessary

The isolation protocol must be optimized for the specific experimental endpoints, whether enzymatic activity measurement, proteomics, or functional assays .

How can I design experiments to determine the effects of environmental stressors on mt-nd3 expression and function?

A comprehensive experimental design to assess environmental stressor effects on mt-nd3 should include:

  • Exposure paradigm:

    • Dose-response relationships (at least 5 concentrations)

    • Time-course analysis (acute vs. chronic exposure)

    • Developmental stage considerations (embryonic vs. larval vs. adult)

    • Recovery period assessment

  • Expression analysis:

    • qRT-PCR for transcript levels

    • Western blotting for protein levels

    • In situ hybridization for spatial expression patterns

  • Functional assessments:

    • Complex I enzymatic activity

    • ROS production measurement

    • ATP synthesis capacity

    • Mitochondrial membrane potential

  • Phenotypic outcomes:

    • Survival and developmental progression

    • Morphological abnormalities

    • Behavioral alterations

    • Tissue-specific effects

  • Mechanistic investigations:

    • Pathway inhibitors to determine mode of action

    • Antioxidant co-treatment to assess ROS involvement

    • Genetic models (e.g., mt-nd3 overexpression) to test resilience

What are the advantages and limitations of different gene editing approaches for studying mt-nd3 in zebrafish?

Various gene editing approaches offer distinct advantages and limitations for mt-nd3 research:

ApproachAdvantagesLimitationsBest Applications
Morpholino knockdown- Rapid implementation
- Dosage control
- No breeding required
- Transient effects
- Off-target effects
- Variable efficacy
Preliminary studies
Short-term phenotyping
CRISPR-Cas9 mutation- Permanent modification
- Heritable changes
- Precise targeting
- Challenging for mtDNA
- Potential lethality
- Time-consuming breeding
Long-term studies
Genetic interaction analysis
Transgenic overexpression- Gain-of-function studies
- Tissue-specific expression
- Tagged protein versions
- Non-physiological levels
- Position effects
- Integration artifacts
Rescue experiments
Protein localization studies
Base editing- Precise nucleotide changes
- Reduced off-targets
- No DSB required
- Limited targeting scope
- Technical complexity
- Efficiency concerns
Modeling specific mutations
Structure-function analysis

When studying mt-nd3, which is encoded in the mitochondrial genome, special considerations are necessary as mitochondrial gene editing presents unique challenges compared to nuclear gene modification .

How might single-cell approaches advance our understanding of mt-nd3 function in zebrafish models?

Single-cell approaches offer transformative potential for mt-nd3 research in zebrafish:

  • Single-cell transcriptomics:

    • Reveals cell type-specific responses to mt-nd3 dysfunction

    • Identifies compensatory mechanisms in resistant cell populations

    • Maps developmental trajectories altered by mitochondrial defects

  • Single-cell metabolomics:

    • Quantifies metabolic adaptations at cellular resolution

    • Detects early metabolic changes preceding phenotypic manifestations

    • Identifies novel biomarkers of mitochondrial dysfunction

  • Live-cell imaging with genetically encoded sensors:

    • Tracks real-time changes in ATP levels, calcium, or ROS

    • Monitors mitochondrial dynamics in specific cell types

    • Visualizes cellular stress responses to mitochondrial dysfunction

  • Spatial transcriptomics:

    • Maps expression changes in anatomical context

    • Identifies tissue microenvironments affecting mitochondrial function

    • Correlates structural and functional alterations

These approaches will enable unprecedented resolution in understanding cell-specific vulnerabilities to mt-nd3 dysfunction and identifying potential therapeutic targets .

What is the potential for using zebrafish mt-nd3 models in high-throughput drug screening?

Zebrafish mt-nd3 models offer exceptional advantages for high-throughput drug screening:

  • Practical advantages:

    • Small size allows screening in 96-well format

    • Rapid development enables quick assessment of outcomes

    • Optical transparency facilitates imaging-based readouts

    • Low compound requirements reduce screening costs

  • Biological relevance:

    • Whole-organism context captures complex physiology

    • Conserved drug metabolism and toxicity mechanisms

    • Ability to assess tissue-specific effects simultaneously

  • Implementation strategies:

    • Automated behavioral analysis for neurological phenotypes

    • Fluorescent reporters for mitochondrial function

    • Metabolic readouts using plate-based respirometry

    • Multiplexed phenotypic endpoints

Zebrafish platforms have already proven valuable for discovering compounds that modulate mitochondrial function. For example, the anticancer drug elesclomol was identified as effective in recovering phenotypes associated with copper deficiency, which impacts cytochrome c oxidase assembly and activity .

How can integrative multi-omics approaches enhance our understanding of mt-nd3 function in zebrafish?

Integrative multi-omics approaches provide comprehensive insights into mt-nd3 function:

  • Combined methodologies:

    • Transcriptomics: Reveals expression changes and compensatory mechanisms

    • Proteomics: Identifies post-transcriptional regulation and protein interactions

    • Metabolomics: Maps metabolic pathway alterations

    • Epigenomics: Detects regulatory mechanisms controlling mitochondrial responses

  • Integration strategies:

    • Network analysis to identify regulatory hubs

    • Pathway enrichment to detect coordinated responses

    • Temporal dynamics to map cause-effect relationships

    • Cross-species comparison to identify conserved mechanisms

  • Computational approaches:

    • Machine learning to predict phenotypic outcomes

    • Systems biology modeling of mitochondrial function

    • In silico drug target identification

This multi-dimensional data integration approach can reveal previously unrecognized connections between mt-nd3 dysfunction and broader cellular processes, potentially identifying novel therapeutic targets for mitochondrial disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.