Recombinant Danio rerio NADH-ubiquinone oxidoreductase chain 4L (mt-nd4l)

Shipped with Ice Packs
In Stock

Description

Production and Expression

The recombinant protein is synthesized using E. coli expression systems, typically fused with a His tag for purification . Key steps include:

  1. Gene Cloning: The mt-nd4l coding sequence is optimized for bacterial codon usage .

  2. Induction: IPTG-induced expression in BL21(DE3) strains .

  3. Purification: Affinity chromatography via Ni-NTA columns .

  4. Quality Control: Validated using SDS-PAGE (>90% purity) and functional assays .

Functional Role in Complex I

As a core subunit of mitochondrial Complex I, recombinant mt-nd4l contributes to:

  • Electron Transfer: Facilitates NADH → ubiquinone electron transport via FMN and Fe-S clusters .

  • Proton Pumping: Conformational changes in mt-nd4l assist in translocating protons across the mitochondrial membrane .

  • Structural Integrity: Knockout studies in Chlamydomonas reinhardtii show that ND4L absence disrupts Complex I assembly, leading to loss of enzymatic activity .

Key Research Findings:

  • Assembly Dependency: In Chlamydomonas, RNAi suppression of ND4L prevents the formation of the 950-kDa Complex I holocomplex .

  • Conservation Across Species: Despite nuclear gene transfer in some algae (e.g., C. reinhardtii), ND4L retains its essential role in eukaryotic Complex I .

Applications in Research

Recombinant mt-nd4l is used in:

  • ELISA Kits: Detects native mt-nd4l in biological samples (e.g., MBS7225312 kit) .

  • Respiratory Chain Studies: Investigates mutations linked to mitochondrial disorders like Leber’s hereditary optic neuropathy (LHON) .

  • Drug Development: Screens for inhibitors targeting Complex I in metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
mt-nd4l; mtnd4l; nd4l; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MTPTHFSLNAAFMLGLAGLTFHRVHLLSALLCLEGMMLSLFISMALWTLKTESMSLSTAP MLLLAFSACEASAGLALLVATARTHGSDHMKNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of mt-nd4l in Danio rerio?

The mt-nd4l gene in Danio rerio (zebrafish) encodes the NADH-ubiquinone oxidoreductase chain 4L protein, a crucial component of mitochondrial complex I. This protein participates in the electron transport chain within mitochondria, specifically in the first step of electron transfer from NADH to ubiquinone. This process is essential for oxidative phosphorylation, the primary pathway for ATP production in cells. In zebrafish, as in other organisms, mt-nd4l plays a critical role in energy metabolism by contributing to the maintenance of the electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis . Zebrafish models have demonstrated that proper functioning of respiratory complexes, including complex I containing mt-nd4l, is essential for normal embryonic development .

What is the molecular structure and sequence characteristics of recombinant Danio rerio mt-nd4l?

Recombinant Danio rerio mt-nd4l is a transmembrane protein consisting of 98 amino acids with the sequence: MTPTHFSLNAAFMLGLAGLTFHRVHLLSALLCLEGMMLSLFISMALWTLKTESMSLSTAPMLLLAFSACEASAGLALLVATARTHGSDHMKNLNLLQC . This protein exhibits hydrophobic properties characteristic of mitochondrial membrane proteins. When produced as a recombinant protein, it is typically expressed with an N-terminal 10xHis-tag to facilitate purification . Unlike mt-nd4l in most species, which is encoded by mitochondrial DNA, research in other organisms like Chlamydomonas reinhardtii has shown cases where ND4L can be encoded in the nuclear genome, with modified hydrophobicity to facilitate import into mitochondria . Analysis of the Danio rerio sequence reveals conservation of key functional domains essential for electron transport activity.

Why is Danio rerio an effective model organism for mt-nd4l research?

Zebrafish (Danio rerio) represents an excellent model organism for mt-nd4l research for several reasons. First, zebrafish embryos develop externally and remain transparent during early development, allowing for direct visualization of mitochondrial processes. Second, zebrafish share significant genetic homology with humans, making findings potentially translatable to human mitochondrial disorders. Third, studies have shown that zebrafish can be effectively used to determine the role of mitochondria in embryogenesis, with research demonstrating that inhibitors of respiratory complex I or II induce developmental abnormalities . Additionally, zebrafish models allow researchers to investigate the relationship between mitochondrial dynamics and the immune system, particularly in processes like phagocytosis and efferocytosis that involve mitochondrial proteins . The availability of genetic manipulation techniques in zebrafish further enhances its utility for studying specific gene functions like mt-nd4l.

How does mt-nd4l contribute to the assembly and function of mitochondrial complex I?

Studies in model organisms have demonstrated that mt-nd4l is essential for the proper assembly and function of mitochondrial complex I. Research using RNA interference techniques against the nuclear-encoded ND4L gene (NUO11) in Chlamydomonas reinhardtii showed that absence of the ND4L polypeptide prevents the assembly of the entire 950-kDa complex I and eliminates enzyme activity . This indicates that mt-nd4l plays a structural role beyond its direct function in electron transport. The assembly process appears to be hierarchical, with mt-nd4l serving as a crucial component around which other subunits organize. The hydrophobic nature of mt-nd4l suggests it is embedded within the membrane domain of complex I, potentially contributing to proton pumping or maintaining the proper conformation of the complex. Researchers investigating complex I assembly should consider a stepwise analysis of intermediates formed in the absence of mt-nd4l to further elucidate its specific role in the assembly pathway.

What methodologies are most effective for studying mt-nd4l mutations and their functional consequences?

Studying mt-nd4l mutations requires a multi-faceted approach combining molecular biology, biochemistry, and advanced imaging techniques. For mutation identification, next-generation sequencing (NGS) with coverage exceeding 1000-fold is recommended, as used in studies of mitochondrial mutations in cancer . When analyzing sequence data, researchers should calculate minor allele frequencies (MAFs) for all mitochondrial-encoded molecules and compare histopathologically confirmed samples with matched normal tissue controls to identify somatic mutations .

For functional analysis of identified mutations, researchers can employ:

  • RNA interference or CRISPR-Cas9 techniques to model mt-nd4l mutations in zebrafish

  • Enzymatic assays to measure complex I activity using spectrophotometric methods

  • Oxygen consumption rate measurements to assess respiratory function

  • Blue native PAGE to analyze complex I assembly

For circulating biomarker development, extracellular vesicle isolation followed by mtDNA sequencing has proven effective in detecting mutations, with mt-nd4l being among the genes frequently harboring mutations in conditions like triple-negative breast cancer .

How is mt-nd4l implicated in human disease models, and how can Danio rerio help elucidate these mechanisms?

The mt-nd4l gene has been implicated in several human diseases, most notably in Alzheimer's disease (AD) and Leber hereditary optic neuropathy (LHON). A study analyzing whole exome sequences from 10,831 participants in the Alzheimer's Disease Sequencing Project identified a rare MT-ND4L variant (rs28709356 C>T) significantly associated with AD risk (P = 7.3 × 10^-5) . Additionally, the T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with LHON, though the exact mechanism by which this mutation leads to vision loss remains uncertain .

Danio rerio models can help elucidate these disease mechanisms through:

  • Creation of transgenic zebrafish expressing human mt-nd4l mutations

  • Analysis of mitochondrial function during embryonic development

  • Evaluation of tissue-specific effects, particularly in neural tissues

  • High-throughput drug screening to identify compounds that rescue mutant phenotypes

Zebrafish models are particularly valuable because inhibitors of respiratory complex I or II induce developmental abnormalities that can be easily visualized and quantified , allowing researchers to connect mt-nd4l dysfunction with specific developmental and pathological outcomes.

What are the optimal storage and handling conditions for recombinant Danio rerio mt-nd4l?

Recombinant Danio rerio mt-nd4l requires specific storage and handling conditions to maintain stability and functionality. According to product specifications, the protein should be stored at -20°C, with extended storage recommended at -20°C or -80°C . Repeated freezing and thawing should be strictly avoided as it can cause protein denaturation and loss of activity. For short-term use, working aliquots can be stored at 4°C for up to one week .

The shelf life of the recombinant protein varies depending on the formulation:

  • Liquid form: approximately 6 months at -20°C/-80°C

  • Lyophilized form: approximately 12 months at -20°C/-80°C

Shelf life is influenced by multiple factors including buffer composition, storage temperature, and the inherent stability of the protein itself. When working with the protein, researchers should maintain sterile conditions and use appropriate buffers that maintain optimal pH and ionic strength for mt-nd4l stability. Since mt-nd4l is a transmembrane protein, consider using detergents or lipid environments that mimic its native membrane context for functional studies.

What subcellular fractionation techniques are most effective for isolating and studying native mt-nd4l?

Effective isolation of native mt-nd4l requires careful subcellular fractionation techniques that preserve mitochondrial integrity. A proven protocol involves:

  • Tissue homogenization in isotonic buffer (typically 250 mM sucrose, 10 mM HEPES-KOH pH 7.4, 1 mM EDTA) supplemented with protease inhibitors (2 mM PMSF), translation inhibitors (200 μg/ml cycloheximide), and RNase inhibitors (10 U/ml RiboLock) .

  • Initial centrifugation at low speed (1500 × g for 10 minutes, repeated twice) to remove nuclei and cellular debris, yielding the post-nuclear supernatant (PNS) .

  • Centrifugation of PNS at 14,000 × g for 15 minutes to pellet the membrane-bound (MB) fraction containing mitochondria .

  • Further centrifugation of the resulting supernatant at 100,000 × g for 60 minutes to separate high-speed (HS) membrane fractions from cytosol .

For enhanced purification, density gradient centrifugation using Percoll or sucrose gradients can be employed. To specifically isolate complex I containing mt-nd4l, blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by complex I in-gel activity assays can be utilized. For immunodetection of mt-nd4l, samples should be incubated with primary antibodies at a 1:200 dilution overnight at 4°C, followed by fluorescent secondary antibodies such as Alexa Fluor 488 .

How can researchers effectively measure complex I activity in relation to mt-nd4l function?

Measuring complex I activity in relation to mt-nd4l function requires specialized biochemical assays that assess electron transport capabilities. The following methodological approaches are recommended:

  • NADH:ubiquinone oxidoreductase activity assay: This spectrophotometric assay measures the rate of NADH oxidation at 340 nm in the presence of ubiquinone. The reaction mixture typically contains 50 mM potassium phosphate buffer (pH 7.4), 0.1 mM NADH, 60 μM ubiquinone, and mitochondrial extract. Specific complex I activity can be determined by using rotenone as an inhibitor.

  • High-resolution respirometry: Using instruments like Oroboros Oxygraph-2k, researchers can measure oxygen consumption rates in isolated mitochondria or intact cells. Substrates that feed electrons to complex I (glutamate/malate or pyruvate/malate) are added sequentially, followed by ADP and specific inhibitors.

  • In-gel activity assays: Following BN-PAGE separation of mitochondrial complexes, gels are incubated in a solution containing NADH and nitrotetrazolium blue (NBT). Active complex I reduces NBT to form purple precipitates, allowing visualization and quantification of activity.

  • Reactive oxygen species (ROS) measurements: Since complex I dysfunction often leads to increased ROS production, fluorescent probes like MitoSOX Red can be used to measure superoxide generation in live cells or isolated mitochondria.

To specifically assess mt-nd4l's contribution to complex I function, researchers can compare activity in normal samples versus those with mt-nd4l mutations or knockdowns. Studies in Chlamydomonas have demonstrated that absence of ND4L completely suppresses complex I enzyme activity , highlighting its essential role.

How should researchers interpret contradictory data regarding mt-nd4l mutations and their phenotypic effects?

When faced with contradictory data regarding mt-nd4l mutations and their phenotypic effects, researchers should implement a systematic approach to resolve discrepancies:

  • Consider heteroplasmy levels: Mitochondrial mutations often exist in heteroplasmic states, with varying ratios of mutant to wild-type mitochondrial DNA. Phenotypic effects typically manifest only when mutation loads exceed a threshold (usually 60-80%). Contradictory findings may result from different heteroplasmy levels across studies. Researchers should quantify and report heteroplasmy percentages using methods like digital PCR or next-generation sequencing .

  • Evaluate genetic background effects: Nuclear genome variations can modify the expression of mt-nd4l mutations. For example, the study on Alzheimer's disease not only found significance with MT-ND4L mutations but also with MT-related nuclear genes like TAMM41 . Consider analyzing nuclear modifiers and perform studies in consistent genetic backgrounds.

  • Assess tissue-specific effects: Mt-nd4l mutations may manifest differently across tissues due to varying energy demands. Contradictory findings might arise from examining different tissues. Studies in zebrafish are valuable as they allow visualization of tissue-specific phenotypes during development .

  • Standardize biochemical assays: Variations in experimental conditions for complex I activity measurements can yield contradictory results. Researchers should:

    • Use multiple complementary methods (spectrophotometric assays, oxygen consumption, in-gel activity)

    • Include appropriate controls (positive, negative, internal)

    • Account for potential compensatory mechanisms

  • Consider environmental factors: Temperature, oxidative stress, and metabolic state can influence how mt-nd4l mutations manifest. Document and control for these variables in experimental designs.

When reporting conflicting results, researchers should explicitly discuss methodological differences and potential biological explanations for discrepancies rather than simply highlighting contradictions.

What are the most reliable biomarkers for assessing mt-nd4l function in zebrafish models?

Reliable biomarkers for assessing mt-nd4l function in zebrafish models span multiple biological levels, from molecular to organismal:

Molecular Biomarkers:

  • Complex I assembly status: Blue Native PAGE analysis to quantify fully assembled complex I versus subcomplexes, which can indicate mt-nd4l integration efficacy

  • NADH:ubiquinone oxidoreductase activity: Direct measurement of complex I enzyme activity using spectrophotometric assays

  • Mitochondrial membrane potential: Using fluorescent dyes like TMRM or JC-1 to assess the electrochemical gradient dependent on complex I function

  • ROS production: Measurement of superoxide and hydrogen peroxide levels as indicators of electron leakage from dysfunctional complex I

  • ATP synthesis rates: Quantification of ATP production in response to complex I substrates

Cellular/Tissue Biomarkers:

  • Mitochondrial morphology: Electron microscopy analysis of cristae structure and mitochondrial network organization

  • Neuronal integrity: Assessment of retinal ganglion cells and optic nerve, particularly relevant given mt-nd4l's involvement in LHON

  • Cardiolipin content: As seen in studies of mitochondrial mutations in cancer, cardiolipin alterations can reflect mitochondrial dysfunction

Organismal Biomarkers:

A multi-parameter approach combining these biomarkers provides the most comprehensive assessment of mt-nd4l function, with particular emphasis on complex I assembly and activity as the most direct indicators of mt-nd4l's primary role.

How might single-cell technologies advance our understanding of mt-nd4l heteroplasmy and its functional consequences?

Single-cell technologies offer unprecedented potential to address fundamental questions about mt-nd4l heteroplasmy and its functional impact that cannot be resolved with bulk tissue analysis:

  • Heteroplasmy distribution mapping: Single-cell mtDNA sequencing can reveal the cell-to-cell variation in mt-nd4l mutation loads within tissues. This approach would help determine whether heteroplasmic mutations are randomly distributed or if selection pressures create mosaic patterns of affected cells. Researchers can employ techniques like single-cell capture followed by whole mitochondrial genome amplification and sequencing.

  • Correlation of mutation load with functional parameters: By combining single-cell mtDNA sequencing with functional readouts like mitochondrial membrane potential or ATP measurements in the same cells, researchers can establish precise threshold effects for specific mt-nd4l mutations. This would address the long-standing question of what heteroplasmy level triggers cellular dysfunction.

  • Lineage tracing of mt-nd4l mutant cells: Using CRISPR-based lineage tracing combined with single-cell RNA-seq in zebrafish embryos would allow researchers to monitor how cells with various levels of mt-nd4l mutations contribute to different tissues during development, potentially revealing selection mechanisms against highly mutated cells.

  • Spatial transcriptomics and proteomics: These approaches can map compensatory nuclear gene expression responses to mt-nd4l mutations at single-cell resolution within intact tissues, identifying cell-specific adaptation mechanisms.

  • Single-cell metabolomics: Emerging technologies for measuring metabolites in individual cells could reveal how mt-nd4l mutations alter metabolic pathways beyond oxidative phosphorylation, potentially identifying new biomarkers and therapeutic targets.

These single-cell approaches would be particularly valuable in zebrafish models, where the transparent embryos allow for in vivo imaging to correlate single-cell molecular data with developmental outcomes in real-time.

What therapeutic approaches might target mt-nd4l dysfunction, and how can Danio rerio models facilitate their development?

Developing therapeutics for mt-nd4l dysfunction represents a significant challenge but also an opportunity for innovative approaches, with Danio rerio offering an excellent platform for screening and validation:

Potential Therapeutic Strategies:

  • Gene therapy approaches:

    • Allotopic expression of recoded mt-nd4l from the nucleus

    • Targeted RNA import into mitochondria to complement defective mt-nd4l

    • Mitochondrial-targeted nucleases for heteroplasmy shifting

  • Pharmacological interventions:

    • Complex I bypass agents (e.g., CoQ10 derivatives, alternative NADH dehydrogenases)

    • Mitochondrial biogenesis stimulators (e.g., PPAR agonists, AMPK activators)

    • Antioxidants specifically targeted to mitochondria (e.g., MitoQ, SS-31 peptides)

    • Modulators of mitochondrial dynamics to promote removal of dysfunctional mitochondria

  • Metabolic bypasses:

    • Alternative substrate utilization enhancers

    • Ketogenic approaches to reduce reliance on complex I

Zebrafish Advantages for Therapeutic Development:

  • High-throughput screening capability: Zebrafish embryos in 96-well plates allow rapid assessment of thousands of compounds for their ability to rescue phenotypes associated with mt-nd4l dysfunction.

  • Visualization of real-time effects: The transparency of zebrafish embryos permits direct observation of how therapeutics affect mitochondrial function in different tissues using fluorescent reporters.

  • Genetic manipulation ease: CRISPR/Cas9 technology in zebrafish enables creation of precise mt-nd4l mutations that model human pathogenic variants , providing disease-relevant models for therapeutic testing.

  • Developmental context: Since inhibition of respiratory complexes causes specific developmental abnormalities in zebrafish , therapeutic efficacy can be assessed by monitoring restoration of normal development.

  • Translation to human applications: Conserved mitochondrial biology between zebrafish and humans increases the translational potential of findings, while the rapid development cycle of zebrafish accelerates the path to potential human applications.

Researchers should establish standardized phenotypic assays in mt-nd4l-deficient zebrafish to enable consistent evaluation of therapeutic candidates, focusing on both biochemical restoration of complex I function and organizational outcomes like normal development and behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.