Recombinant Danio rerio Neurexin-3a-beta (nrxn3a)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Danio rerio Neurexin-3a-beta (nrxn3a) is a protein expressed in E. coli and fused to an N-terminal His tag . Neurexins, including nrxn3a, are transmembrane neuronal glycoproteins that play a crucial role in synapse development and function . Danio rerio, commonly known as zebrafish, is an important model organism in biological research, allowing scientists to study gene functions and biological processes .

Gene Information

Nrxn3a is encoded by the nrxn3a gene in zebrafish . The gene aliases include im:7144250, nrxn3aa, nrxn3ab, and wu:fj54c11 .

Research Findings

  • Synapse Development: Studies have shown that Nrxn3 is crucial for ribbon synapse maturation . In zebrafish, loss of Nrxn3 results in a decrease in ribbon-synapse numbers and disrupts pre- and postsynaptic pairing .

  • Synapse Morphology: Loss of Nrxn3 can alter synapse morphology and the clustering of synaptic components. In nrxn3a; nrxn3b mutants, the average size of paired presynapses is increased .

Functional Studies in Zebrafish

Zebrafish lacking α-Nrxn3 exhibit a significant reduction in ribbon synapses within hair cells. Early development appears normal in nrxn3a; nrxn3b mutants, but later stages reveal a failure in synapse pairing, leading to a loss of postsynapses .

Effects on Synapse Numbers

GenotypeComplete Ribbon SynapsesUnpaired PresynapsesUnpaired Postsynapses
α-nrxn3a mutantsSlight ReductionNo DifferenceNo Difference
α-nrxn3b mutantsSlight ReductionSignificantly MoreNo Difference
α-nrxn3a; α-nrxn3b mutants60% ReductionDramatic IncreaseDramatic Increase

Effects on Synapse Size

Synaptic ComponentGenotypeAverage Size
Paired Presynapsesnrxn3a; nrxn3b mutantsIncreased
Unpaired Presynapsesnrxn3a; nrxn3b mutantsSimilar
Paired Postsynapsesnrxn3a; nrxn3b mutantsIncreased
Unpaired Postsynapsesnrxn3a; nrxn3b mutantsSimilar

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nrxn3a; Neurexin-3a-beta; Neurexin IIIb-beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
536-672
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
nrxn3a
Target Protein Sequence
KPQPDIVLLPLPTSYEVDNTKMKSPLITSPMFRNVPTAIPTEPGIRRVPGASEVVRESSS TTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYITNSAQSNGAVMKDKQQS TKSGNKKQKNKDKEYYV
Uniprot No.

Target Background

Function

Neuronal cell surface protein potentially involved in cell recognition and adhesion.

Database Links

UniGene: Dr.109337

Protein Families
Neurexin family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What expression systems are optimal for producing recombinant Neurexin-3a-beta?

Recombinant Neurexin-3a-beta (nrxn3a) can be expressed in multiple host systems, each offering distinct advantages. E. coli and yeast expression systems typically provide the highest yields and shortest production timelines, making them suitable for structural studies requiring large protein quantities . For functional studies where post-translational modifications are critical, insect cells (with baculovirus) or mammalian cell expression systems are preferable as they maintain proper protein folding and activity . When designing your expression strategy, consider implementing codon optimization for the target host and including purification tags that can be removed post-purification to minimize interference with protein function.

Expression SystemYieldTurnaround TimePost-translational ModificationsRecommended Applications
E. coliHighShort (3-5 days)MinimalStructural studies, antibody production
YeastHighMedium (5-7 days)PartialProtein-protein interaction studies
Insect cellsMediumLong (10-14 days)Near-completeFunctional assays, binding studies
Mammalian cellsLowLong (14+ days)CompleteActivity assays, physiological studies

How do α and β isoforms of Neurexin-3 differ functionally in neural systems?

Neurexin-3α (Nrxn3α) and Neurexin-3β (Nrxn3β) exhibit distinct functional properties in neural systems. Rescue experiments in Neurexin-3 knockout models demonstrate that only Nrxn3α, not Nrxn3β, supports inhibitory synaptic transmission in olfactory bulb neurons . This functional distinction likely stems from structural differences - Nrxn3α contains the LNS2 domain with the SS2 splicing site that is absent in Nrxn3β . When designing experiments to investigate specific isoform functions, incorporate controls that account for these structural differences and consider using paired electrophysiological recordings to directly measure the functional impact of each isoform on synaptic transmission.

What detection methods are available for studying Danio rerio nrxn3a expression?

For detecting Danio rerio nrxn3a, researchers have several methodological options. Antibody-based approaches include polyclonal antibodies specific for zebrafish nrxn3a applicable in ELISA assays . For transcript-level analysis, RT-PCR provides a reliable method for detecting and quantifying different splice variants of nrxn3a, as demonstrated in studies examining SS2 and SS4 alternative splicing . When implementing these methods, include appropriate negative controls and consider using multiple detection approaches to cross-validate your findings. For in situ visualization, fluorescently tagged constructs can be employed for live imaging in zebrafish embryos to track expression patterns during development.

How does alternative splicing at SS2 and SS4 sites regulate nrxn3a function in inhibitory synaptic transmission?

Alternative splicing at SS2 and SS4 sites creates a combinatorial code that precisely regulates Nrxn3α function at inhibitory synapses. Research indicates that Nrxn3α requires either SS2 or SS4 to lack an insert for proper inhibitory synapse function . The SS2 splice site appears dominant in this code, as even when SS4 lacks an insert, the presence of the longer insert in SS2 (SS2ab) blocks Nrxn3α function .

For investigating this regulatory mechanism, implement rescue experiments in Nrxn3-deficient neurons using constructs with specific splice variants. Utilize electrophysiological recordings to measure inhibitory postsynaptic currents (IPSCs), paired with analyses of coefficient of variation to assess release probability. This methodological approach has revealed that Nrxn3α SS2- variants restore normal inhibitory transmission in olfactory bulb and prefrontal cortex neurons, while SS2ab variants do not .

Splice VariantSS2 StatusSS4 StatusEffect on Inhibitory Synaptic Transmission
Nrxn3α SS2-/SS4-No insertNo insertFully functional
Nrxn3α SS2-/SS4+No insertWith insertFunctional
Nrxn3α SS2a/SS4-With 'a' insertNo insertPartially functional
Nrxn3α SS2ab/SS4-With 'ab' insertNo insertNon-functional
Nrxn3β (any variant)N/A (lacks SS2)AnyNon-functional at inhibitory synapses

What experimental approaches effectively characterize the nrxn3a-dystroglycan binding interaction?

The trans-synaptic interaction between presynaptic Nrxn3α and postsynaptic dystroglycan is crucial for inhibitory synapse function. To characterize this interaction, implement a multi-modal approach combining biochemical, structural, and functional analyses.

For biochemical characterization, use pull-down assays with recombinant Nrxn3α LNS2 domain variants and dystroglycan to determine binding affinities. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provide quantitative binding kinetics. Structurally, X-ray crystallography or cryo-EM of the complex can reveal binding interfaces.

Functionally, employ a dual genetic approach: conditional knockout of Nrxn3 in presynaptic neurons and dystroglycan in postsynaptic neurons, followed by electrophysiological recordings. Studies have shown that both presynaptic Nrxn3 deletion and postsynaptic dystroglycan deletion produce similar phenotypes in olfactory bulb and prefrontal cortex inhibitory synapses - specifically, reduced release probability resulting in ~50% decreased inhibitory synaptic strength . The minimal Nrxn3α-LNS2 SS2- construct that binds dystroglycan fully rescues these deficits, confirming that this interaction is both necessary and sufficient for proper inhibitory synapse function .

How should researchers design experiments to investigate nrxn3a's role in neurodevelopmental and neuropsychiatric disorders?

To investigate nrxn3a's role in neuropsychiatric disorders, design experiments that integrate genetic, molecular, and functional approaches. NRXN3 gene variants have been associated with autism, addiction, schizophrenia, and potentially Alzheimer's disease , necessitating multifaceted experimental strategies.

For genetic studies, focus on specific polymorphisms like rs8019381, which produces altered expression of transmembrane versus soluble NRXN3 isoforms . When studying Alzheimer's disease connections, investigate the interaction between NRXN3 and APOE genotypes, as research indicates they interact and alter NRXN3 transmembrane/soluble isoform expression in AD postmortem cortex .

At the molecular level, quantify expression ratios between transmembrane and soluble NRXN3 isoforms in disease models. Studies in AD postmortem brains show reduced expression and altered ratios of these isoforms, which inversely correlate with inflammasome component NLRP3 expression in AD brain regions .

For functional studies, employ neuronal cultures and animal models with specific NRXN3 splice variants to assess synaptic function. Use electrophysiology to measure synaptic transmission, paired with imaging techniques to visualize synaptic structure.

Disease AssociationRelevant Genetic VariantsExperimental ApproachesKey Molecular Interactions
Alzheimer's Diseasers8019381 splicing alleleCompare isoform ratios in postmortem tissue; APOE genotype interactionsNRXN3-Neuroligin-AβO; NRXN3-NLRP3 correlations
AutismVarious NRXN3 variantsAssess inhibitory/excitatory balance in neural circuitsDystroglycan binding alterations
AddictionNRXN3 polymorphismsNeurotransmitter release studies; reward circuit analysisPresynaptic organization changes
SchizophreniaNRXN3 expression variantsInhibitory circuit function assessmentRelease probability alterations

What methodological considerations are important when studying the minimal functional domain of nrxn3a?

When investigating the minimal functional domain of Nrxn3α, several methodological considerations are critical. Research has identified the LNS2 domain lacking an insert at SS2 (Nrxn3α-LNS2 SS2-) as sufficient for maintaining inhibitory synaptic function . To study this domain effectively:

First, design domain-specific constructs with precise boundaries based on structural information to avoid disrupting folding. Include appropriate trafficking signals and membrane anchors if testing membrane localization. For rescue experiments, ensure cell-type specificity using appropriate promoters (e.g., human synapsin-1 for neuronal expression) .

When assessing functional rescue, employ multiple parameters: evoked IPSC amplitude, paired-pulse ratio, rise and decay times, and coefficient of variation of responses. These combined measurements provide comprehensive insight into synaptic function beyond simple strength measurements. Studies of olfactory bulb and prefrontal cortex inhibitory synapses demonstrated that Nrxn3α-LNS2 SS2- fully rescued multiple electrophysiological parameters in Nrxn3-deficient neurons .

To confirm that the minimal domain's function mirrors the full-length protein, perform parallel binding assays with dystroglycan and functional rescue experiments. This approach reveals whether the minimal domain recapitulates all essential protein-protein interactions of the full-length protein.

How can apparent contradictions in nrxn3a research data be reconciled and addressed experimentally?

When encountering contradictory data in nrxn3a research, implement systematic approaches to reconcile these discrepancies. First, carefully analyze differences in experimental systems - cell type, brain region, and developmental stage significantly impact nrxn3a function and splicing patterns. For example, in the olfactory bulb, inhibitory neurons express almost exclusively Nrxn3α SS2- (>99%), while mitral cells express both Nrxn3α SS2- and Nrxn3α SS2a variants (~55% vs 45%) .

Second, address methodological differences in knockout strategies. Cell-type specific conditional knockouts reveal distinct phenotypes compared to global knockouts due to compensatory mechanisms. Studies using postsynaptic versus presynaptic Nrxn3 deletions show that Nrxn3 functions primarily presynaptically in regulating inhibitory synaptic transmission .

Third, when contradictory results emerge regarding splice variant function, design experiments that systematically test each splice variant in identical experimental conditions. The combinatorial splice code where either SS2 or SS4 must lack an insert for proper function explains why some studies find SS4+ variants functional while others do not .

Finally, when conflicting data emerges across species, perform parallel experiments in multiple model systems. While core functions of neurexins are conserved, species-specific differences in splice variant expression and binding partner availability may exist.

What are the most promising future directions for nrxn3a research?

Future nrxn3a research should focus on several high-impact directions. First, investigating the atomic-level structural basis of the Nrxn3α-dystroglycan interaction would provide crucial insights for developing targeted therapeutic approaches. Second, exploring the mechanisms by which presynaptic Nrxn3α binding to postsynaptic dystroglycan influences presynaptic release machinery organization represents a fundamental question in synapse biology.

Third, comprehensive characterization of nrxn3a splicing regulation across development and in disease states could identify critical temporal windows for therapeutic intervention. Fourth, expanding cross-species comparative analyses would clarify evolutionary conservation of nrxn3a function, particularly in zebrafish models that offer advantages for developmental and genetic studies.

Finally, exploring the potential of nrxn3a as a therapeutic target for disorders involving inhibitory synaptic dysfunction represents a promising translational direction. The identification of the minimal functional domain (Nrxn3α-LNS2 SS2-) provides a specific structural target for developing modulators of inhibitory synaptic function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.