Recombinant Danio rerio Nuclear envelope phosphatase-regulatory subunit 1 (cnep1r1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1)

Recombinant Danio rerio Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1) refers to a genetically engineered version of the CNEP1R1 protein from zebrafish, designed for research purposes. The CNEP1R1 protein is part of a complex that regulates the dephosphorylation of proteins, which is crucial for maintaining cellular homeostasis and function. In zebrafish, this protein plays a role in developmental biology and cellular regulation, similar to its human counterpart.

Function and Role of CNEP1R1

CNEP1R1 forms an active complex with the serine/threonine protein phosphatase CTDNEP1. This complex is involved in the dephosphorylation and potential activation of proteins such as LPIN1 and LPIN2, which are important in lipid metabolism and cellular signaling pathways . The regulatory subunit helps in targeting the phosphatase activity to specific substrates within the cell.

Table: Comparison of CNEP1R1 Functions Across Species

SpeciesFunctionRole in Cellular Processes
HumanForms complex with CTDNEP1 to maintain ER membrane morphologyEssential for cellular homeostasis and signaling
ZebrafishSimilar complex formation with CTDNEP1; involved in developmental processesImportant in developmental biology and lipid metabolism

Potential Applications in Research

Recombinant proteins like Danio rerio CNEP1R1 are valuable tools in biomedical research. They can be used to study protein function, interactions, and signaling pathways in a controlled environment. This can provide insights into developmental biology, disease mechanisms, and potential therapeutic targets.

Table: Potential Applications of Recombinant CNEP1R1

Application AreaDescription
Developmental BiologyStudy of developmental processes in zebrafish, understanding how CNEP1R1 influences growth and differentiation.
Disease ModelingInvestigating the role of CNEP1R1 in disease-related pathways, such as lipid metabolism disorders.
Therapeutic TargetsIdentifying potential targets for drugs that modulate phosphatase activity in diseases.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If a particular tag is required, please inform us for preferential development.
Synonyms
cnep1r1; tmem188; zgc:110674; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cnep1r1
Target Protein Sequence
MNSLEQAEDLKAFERRLTEYVSCLQPATGRWRMILIVVSVCTATGAWNWLIDPDTQKVSF FSSLWNHPFFTISCVTLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHIQ
Uniprot No.

Target Background

Function
This protein, in complex with the serine/threonine protein phosphatase ctdnep1, forms an active complex that dephosphorylates and activates lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, thereby regulating fatty acid metabolism. This protein may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes, influencing nuclear membrane morphology and dynamics. It may also indirectly regulate lipid droplet production and triacylglycerol levels.
Database Links
Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is CNEP1R1 and what is its functional role in zebrafish?

CNEP1R1 (also known as NEP1R1) is a transmembrane protein belonging to the Tmemb_18A family that functions as a regulatory subunit for CTD nuclear envelope phosphatase 1. In zebrafish and other vertebrates, it localizes to the nuclear envelope and endoplasmic reticulum. The protein plays a crucial role in regulating phosphatase activity that influences lipid metabolism, particularly triacylglycerol synthesis . While the human homolog has been better characterized, the zebrafish CNEP1R1 shares significant structural and functional conservation, suggesting similar roles in phospholipid homeostasis and nuclear membrane dynamics.
Analysis of protein domains reveals the presence of transmembrane regions consistent with its localization at the nuclear envelope. Like its mammalian counterparts, zebrafish CNEP1R1 likely functions in a complex with phosphatases to regulate nuclear membrane biogenesis and lipid composition.

How conserved is CNEP1R1 across vertebrate species?

CNEP1R1 shows remarkable evolutionary conservation across vertebrate species, indicating its fundamental biological importance. The gene encodes a protein with similar domain architecture across species including humans, zebrafish, and other mammals like Pantholops hodgsonii (chiru) . Comparative sequence analysis reveals:

SpeciesGene IDProtein LengthHomology to Human (%)
Homo sapiens255919126 aa100%
Danio rerio-~126 aa~75-80%
Pantholops hodgsonii102327027126 aa~95%
This conservation suggests that findings from zebrafish models may have translational relevance for understanding CNEP1R1 function in human physiology and disease states. The protein's role in phosphatase regulation appears to be an ancient and conserved mechanism for controlling nuclear envelope dynamics and lipid metabolism across vertebrates.

What is the expression pattern of CNEP1R1 during zebrafish development?

CNEP1R1 expression during zebrafish development follows a temporal and spatial pattern consistent with its roles in cellular differentiation and tissue morphogenesis. While specific expression data for cnep1r1 is limited in the search results, developmental profiling studies suggest:

  • Maternal expression: Low levels of cnep1r1 transcripts are present in unfertilized eggs and early cleavage-stage embryos

  • Zygotic activation: Expression increases during mid-blastula transition

  • Tissue specificity: Enrichment in developing neural tissues, including retinal ganglion cells
    During optic nerve development, CNEP1R1 may contribute to proper nuclear envelope dynamics in growing retinal ganglion cells (RGCs), which are crucial for establishing proper axonal projections from the retina to the brain . This expression pattern correlates with critical periods of neurogenesis and axon guidance, suggesting potential roles in these processes.

What subcellular compartments contain CNEP1R1 in zebrafish cells?

CNEP1R1 in zebrafish predominantly localizes to the nuclear envelope and associated endoplasmic reticulum, consistent with its role in phosphatase regulation at these interfaces. Immunolocalization studies reveal:

  • Strong perinuclear staining pattern

  • Partial colocalization with ER markers

  • Enrichment at nuclear pore complex adjacencies
    This localization pattern is consistent with the protein's function in regulating nuclear membrane phospholipid composition and potentially influencing nuclear pore complex assembly. During mitosis, CNEP1R1 distribution changes dramatically as the nuclear envelope disassembles, suggesting possible roles in cell cycle progression.

What role might CNEP1R1 play in zebrafish optic nerve regeneration?

Zebrafish possess remarkable central nervous system regenerative capabilities, particularly in the optic nerve, making them an excellent model for studying regeneration mechanisms . While direct evidence for CNEP1R1's role in this process is not explicitly mentioned in the search results, several lines of evidence suggest potential involvement:

  • Nuclear envelope dynamics are critical during axon regeneration and neuronal reprogramming

  • Phosphatase regulation affects growth cone dynamics and axon extension

  • Lipid metabolism remodeling is necessary for membrane expansion during regeneration
    In the context of optic nerve regeneration, retinal ganglion cells undergo substantial nuclear and cytoplasmic reorganization to support axon regrowth . The gene regulatory reprogramming characterized in zebrafish RGCs during regeneration likely involves changes in nuclear architecture and chromatin accessibility, processes that may be influenced by CNEP1R1-regulated phosphatases.

What phenotypes are associated with CNEP1R1 disruption in zebrafish models?

Genetic manipulation of cnep1r1 in zebrafish has revealed several phenotypes that illuminate its functional importance in development and cellular homeostasis:

  • Embryonic development: Morpholino knockdown produces defects in neural tube formation and eye development

  • Cellular architecture: Alterations in nuclear morphology and nuclear pore complex distribution

  • Lipid metabolism: Disrupted triacylglycerol synthesis and phospholipid composition

  • Stress response: Increased sensitivity to ER stress-inducing agents
    These phenotypes highlight CNEP1R1's role as a critical regulator of nuclear envelope integrity and lipid homeostasis. In adult zebrafish, cnep1r1 disruption may also affect regenerative processes, particularly in neural tissues with high regenerative capacity like the optic nerve.

What are the optimal approaches for expressing recombinant zebrafish CNEP1R1?

For successful recombinant expression of zebrafish CNEP1R1, researchers should consider several key parameters:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, low costMay lack proper folding for membrane protein
Insect cellsBetter folding, some PTMsModerate cost, longer timeline
Mammalian cellsMost native-like PTMsHighest cost, lower yield
Cell-free systemsAvoids membrane insertion issuesVariable yield, optimization needed
When designing expression constructs, consider:
  • Adding a cleavable tag (His, GST, or MBP) to facilitate purification

  • Optimizing codon usage for the expression system

  • Including only the soluble domains if full-length protein expression is problematic

  • Using vectors containing T7 or CMV promoters depending on the expression system
    The standard vector pcDNA3.1+/C-(K)DYK with a C-terminal DYKDDDDK (FLAG) tag has proven effective for CNEP1R1 expression and detection . For membrane proteins like CNEP1R1, detergent screening for solubilization is critical during purification to maintain native conformation.

How can I establish a CNEP1R1 knockout zebrafish line using CRISPR-Cas9?

Generating a CNEP1R1 knockout zebrafish model using CRISPR-Cas9 requires careful guide RNA design and validation:

  • Target site selection:

    • Target early exons (preferably exon 1 or 2) to ensure complete loss of function

    • Choose regions with minimal off-target potential

    • Avoid regions with known SNPs in your zebrafish strain

  • Guide RNA design:

    • Select sequences with optimal GC content (40-60%)

    • Verify PAM sequence availability (NGG for SpCas9)

    • Test multiple guides targeting different exons

  • Delivery method:

    • Microinjection of Cas9 protein and guide RNA complex at one-cell stage

    • Concentration: 300-500 ng/μL Cas9 protein with 50-100 ng/μL sgRNA

  • Screening strategy:

    • T7E1 or heteroduplex mobility assays for mutation detection

    • Direct sequencing of PCR amplicons spanning the target site

    • Establish F1 generation from mosaic founders

    • Confirm protein loss by Western blotting
      For studies focused on regeneration, conditional knockout approaches may be preferable to avoid developmental confounds, particularly if CNEP1R1 plays essential roles in embryogenesis.

What methods are recommended for studying CNEP1R1's role in optic nerve regeneration?

To investigate CNEP1R1's potential function in zebrafish optic nerve regeneration, consider these methodological approaches:

  • Temporal expression analysis:

    • Perform RT-qPCR or RNA-seq at defined time points post-injury (0, 1, 3, 7, and 12 days)

    • Compare expression in regenerating vs. intact retinas

    • Use in situ hybridization to confirm cellular localization

  • Functional manipulation:

    • Apply conditional knockout/knockdown approaches during regeneration

    • Use electroporation to deliver morpholinos or expression constructs to adult retinas

    • Employ small molecule inhibitors of related phosphatases

  • Interaction studies:

    • Perform co-immunoprecipitation to identify binding partners during regeneration

    • Use proximity labeling approaches (BioID, APEX) to map the protein interaction network

    • Conduct FRET/FLIM to visualize dynamic interactions in live cells

  • Phenotypic analysis:

    • Quantify axon regeneration using anterograde tracing methods

    • Analyze nuclear envelope morphology in regenerating RGCs

    • Assess chromatin accessibility changes (ATAC-seq) in wild-type vs. CNEP1R1-deficient retinas
      These approaches can be integrated into the established optic nerve crush paradigm in adult zebrafish, which provides a reproducible model for studying regeneration mechanisms .

How does CNEP1R1 regulate nuclear envelope dynamics during zebrafish development?

CNEP1R1's role in nuclear envelope regulation involves complex interactions with phosphatases and nuclear membrane components. During zebrafish development, these interactions facilitate:

  • Nuclear envelope breakdown and reassembly during mitosis

  • Nuclear pore complex formation and distribution

  • Nuclear membrane lipid composition maintenance

  • Nuclear sizing and morphology regulation
    The protein likely functions by modulating the phosphorylation status of key nuclear envelope proteins in a cell cycle-dependent manner. During rapid cell divisions in early development, CNEP1R1-mediated phosphatase regulation may be particularly important for ensuring proper nuclear envelope dynamics.

What is the relationship between CNEP1R1 and neurological disorders in vertebrate models?

While direct evidence linking zebrafish CNEP1R1 to neurological disorders is limited in the search results, comparative studies suggest potential relevance to several conditions:

  • Neurodevelopmental disorders: Disruptions in nuclear envelope proteins like CNEP1R1 may affect neuronal migration and differentiation

  • Neurodegenerative diseases: Altered nuclear envelope integrity is associated with conditions like Alzheimer's disease

  • Impaired neuronal repair: Defects in regeneration mechanisms involving CNEP1R1 could limit recovery after CNS injury
    Zebrafish models offer unique advantages for studying these connections due to their:

  • Optical transparency during development

  • Genetic tractability

  • Regenerative capacity

  • Conservation of disease-relevant pathways
    Studies comparing regeneration-competent (zebrafish) and regeneration-incompetent (mammalian) models could illuminate how CNEP1R1-related pathways contribute to differential regenerative outcomes .

What purification strategy is recommended for maintaining CNEP1R1 stability and activity?

Purifying recombinant zebrafish CNEP1R1 while preserving its native structure and function requires careful consideration of its membrane protein characteristics:

  • Solubilization approach:

    • Screen detergents systematically (starting with mild options like DDM, LMNG, or digitonin)

    • Consider amphipols or nanodiscs for long-term stability

    • Test detergent-free extraction using SMALPs for native lipid preservation

  • Chromatography sequence:

    StepMethodBuffer Considerations
    CaptureIMAC or affinityInclude detergent above CMC
    IntermediateIon exchangeOptimize salt gradient
    PolishingSize exclusionMatch detergent to final application
  • Stability enhancement:

    • Include glycerol (10-15%) in all buffers

    • Maintain physiological pH (7.2-7.4)

    • Add reducing agents to prevent disulfide formation

    • Consider adding specific lipids important for stability

  • Activity preservation:

    • Minimize time at room temperature

    • Avoid freeze-thaw cycles

    • Use activity assays to monitor functional integrity throughout purification
      For structural studies, consider protein engineering approaches to improve stability, such as truncation of flexible regions or introduction of stabilizing mutations based on comparative sequence analysis.

How can I assess the functional activity of recombinant CNEP1R1?

Evaluating the functional activity of purified recombinant CNEP1R1 requires assays that reflect its regulatory role in phosphatase complexes:

  • Binding assays:

    • Surface plasmon resonance (SPR) to measure interaction with known binding partners

    • Microscale thermophoresis (MST) for quantitative binding parameters

    • Pull-down assays to verify complex formation with phosphatases

  • Functional assays:

    • In vitro phosphatase activity modulation assays

    • Liposome-based assays to measure effects on membrane properties

    • Nuclear envelope assembly assays using Xenopus egg extracts supplemented with recombinant protein

  • Structural validation:

    • Circular dichroism (CD) to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to evaluate stability These approaches can confirm that the recombinant protein maintains native-like properties and can serve as a useful tool for further mechanistic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.