Recombinant Danio rerio Nucleolar complex protein 4 homolog (noc4l)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Nucleolar Complex Protein 4 Homolog (noc4l)

The recombinant Danio rerio Nucleolar complex protein 4 homolog (noc4l) is a zebrafish-derived protein engineered for research applications, particularly in studying nucleolar and ribosomal biogenesis. This protein belongs to the Noc4 family, which is conserved across eukaryotes and plays critical roles in ribosome assembly and cell proliferation. Its recombinant form is optimized for biochemical assays, such as ELISA, and is commercially available in purified formats .

Subcellular Localization and Role in Ribosome Biogenesis

While the zebrafish protein’s localization is not explicitly studied, mammalian Noc4l homologs exhibit cytoplasmic granule localization and nucleolar interactions . Functional studies in mice reveal that Noc4l deficiency disrupts ribosome biogenesis, leading to embryonic lethality during the morula stage . This suggests conserved roles in:

  1. 18S rRNA processing: Critical for 40S ribosomal subunit maturation.

  2. Cell proliferation: Required for rapid protein synthesis in dividing cells .

Use in ELISA and Antibody Validation

Recombinant noc4l is utilized as an antigen in ELISA kits to detect anti-noc4l antibodies in zebrafish or cross-reactive species . This facilitates studies on:

  • Protein expression profiling in developmental or disease models.

  • Immune response modulation, particularly in macrophages, where Noc4l homologs regulate TLR4/TRIF signaling .

Amino Acid Sequence Highlights

The full-length sequence of Danio rerio noc4l spans 525 residues, with key functional domains:

DomainResiduesFunction
N-terminal region1–150Interaction with ribosomal assembly factors
Central domain151–300Binding to nucleolar proteins
C-terminal region301–525Localization signals and regulatory motifs

Note: Specific motifs (e.g., RNA-binding domains) require further structural characterization .

Challenges and Future Directions

  • Limited zebrafish-specific data: Most functional insights derive from mammalian homologs.

  • Therapeutic potential: Requires validation in zebrafish models of disease (e.g., obesity, cancer).

  • Structural studies: Crystallization efforts needed to map domain interactions.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
noc4l; zgc:110429; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
noc4l
Target Protein Sequence
MAPSGDSNVKEHNNQVSYKKAINTKTDLILQNKKHANDIFDVIEYLQSEKEKEIIFATNA CSKIFCELIERGDLFVGELPKEEDLAQGDRSAEEKYHIFMRHRYNSCVELMLENVSHESF QVKETSLCAVMKFVATEGKHPLQNLDWSEHYNFPRELIQALVEHLLSEKEDMSLLISRFQ EFMEKDDVRYYVMSSVRYSTATVMERNKKAVIPVFQNNVFNLLTTINIPNQASEMTNFLV QQQSKHDDWKAAKLKEHKRAFEQMWLLFLRYKLPGSMYKKILVILHESILPQMSDPKLMM DFLSAAYDIGGAISLSALNGLFVPIHEHNLDYPDFYKKLYNLLDPSIFHVKYRARFFHLA NIFLSSTHLPVYLVAAFVKRLARLSLTAPPTALLILLPFICNLIRRHPSCRVLIHRPSAA DEPCDDPYVMEEEDPAQCHALESSLWEIKTLQNHHHPDVSKAATMINEPLSAQEEDISEL LELTTFELMERELKGEKKTVPLEFDMATDLLKSSREVLGVHFTLE
Uniprot No.

Target Background

Database Links
Protein Families
CBF/MAK21 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Nucleus, nucleolus.

Q&A

What is Nucleolar complex protein 4 homolog (noc4l) in zebrafish?

Nucleolar complex protein 4 homolog (noc4l) is a protein encoded by the noc4l gene in Danio rerio (zebrafish). It is also known as NOC4 protein homolog, NOC4-like protein, or Nucleolar complex-associated protein 4-like protein. While traditionally associated with ribosome biosynthesis in yeast, where NOC4 mediates 40S ribosomal subunit synthesis, research has revealed unexpected locations and functions of NOC4L in vertebrates, particularly in macrophages. The protein has been identified with UniProt accession number Q4VBT2 and consists of a 525 amino acid sequence .

What biological functions has noc4l been implicated in?

Recent research has demonstrated that noc4l plays unexpected roles beyond ribosome biosynthesis, particularly in immune function and metabolism. Key findings include:

  • Preferential expression in human and mouse macrophages

  • Involvement in glucose metabolism and insulin resistance (IR)

  • Interaction with TLR4 (Toll-like receptor 4) to inhibit its endocytosis and block the TRIF pathway

  • Role in ameliorating low-grade systemic inflammation (LSI)

  • Negative correlation with blood glucose levels

These findings suggest noc4l has evolved specialized functions in vertebrates different from its yeast counterpart, particularly in macrophage-mediated inflammatory responses and metabolic regulation .

How can zebrafish be used as a model for studying noc4l function?

Zebrafish (Danio rerio) provide an excellent vertebrate model for studying noc4l function due to:

  • Genetic tractability: Zebrafish genome is fully sequenced and shares high homology with humans

  • Optical transparency of embryos: Enables real-time visualization of developmental processes

  • Rapid development: Facilitates time-efficient studies

  • Availability of gene-editing tools: CRISPR/Cas9 can generate noc4l knockout or knockdown models

  • Conservation of metabolic and inflammatory pathways: Allows translational insights relevant to human health

Researchers can use techniques such as morpholino knockdown, CRISPR/Cas9 gene editing, and transgenic approaches to modulate noc4l expression and study its effects on development, inflammation, and metabolism. Body condition scoring systems have been developed for adult zebrafish, which can be useful when studying metabolic phenotypes associated with noc4l manipulation .

What phenotypes are observed in noc4l-deficient models?

Based on research findings, noc4l-deficient models demonstrate several significant phenotypes:

PhenotypeObservation in Noc4l-deficient ModelsMeasurement Method
Insulin ResistanceImpaired glucose tolerance and insulin sensitivityGlucose Tolerance Test (GTT), Insulin Tolerance Test (ITT)
InflammationIncreased pro-inflammatory cytokine production (IL-6, TNFα)RT-qPCR, ELISA
Metabolic AbnormalitiesElevated serum insulin, free fatty acids, triglycerides, and cholesterolBiochemical assays
Macrophage PolarizationEnhanced M1-like (pro-inflammatory) macrophage polarizationFlow cytometry, gene expression analysis
AKT SignalingAttenuated insulin-stimulated AKT (Ser473) phosphorylationWestern blot

These phenotypes were observed specifically in macrophage-specific Noc4l knockout mice (Noc4l LKO), highlighting the protein's importance in macrophage function and metabolic regulation .

What are the recommended storage and handling conditions for recombinant noc4l protein?

For optimal stability and activity of recombinant Danio rerio noc4l protein:

  • Storage temperature: Store at -20°C, and for extended storage, conserve at -20°C or -80°C

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for this protein

  • Aliquoting: Create working aliquots to avoid repeated freeze-thaw cycles

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week

  • Freeze-thaw considerations: Repeated freezing and thawing is not recommended

Following these guidelines will help maintain protein integrity and functionality for experimental applications .

What techniques can be used to study noc4l interactions with TLR4 and other proteins?

Several methodological approaches can be employed to investigate noc4l interactions with TLR4 and other potential binding partners:

  • Co-immunoprecipitation (Co-IP): To verify physical interaction between noc4l and TLR4

  • Proximity ligation assay (PLA): For in situ detection of protein-protein interactions

  • Fluorescence resonance energy transfer (FRET): To study dynamic interactions in living cells

  • Surface plasmon resonance (SPR): For quantitative binding kinetics analysis

  • Yeast two-hybrid screening: To identify novel interaction partners

  • CRISPR/Cas9-mediated tagging: For live imaging of protein interactions

  • Mass spectrometry-based interactomics: For comprehensive protein interaction network analysis

These techniques can reveal not only the existence of interactions but also their dynamics, localization, and functional significance in different cellular contexts, particularly in understanding how noc4l regulates TLR4 endocytosis and the TRIF pathway .

What assays can quantify the effects of noc4l on inflammatory pathways?

To measure noc4l's impact on inflammatory signaling pathways, researchers can employ:

  • Cytokine profiling: ELISA or multiplex assays for IL-6, TNFα, and other inflammatory mediators

  • Gene expression analysis: RT-qPCR for inflammatory genes regulated by TLR4/TRIF pathway

  • Western blotting: Phosphorylation status of downstream signaling molecules (MAPK, NF-κB)

  • Flow cytometry: Macrophage polarization markers (M1 vs. M2)

  • Reporter assays: NF-κB or ISRE luciferase reporters to measure pathway activation

  • Endocytosis assays: Fluorescently labeled TLR4 to track internalization rates

  • In vivo inflammation models: LPS challenge (1 mg/kg) followed by glucose tolerance testing

These methodological approaches can quantitatively assess how noc4l modulates inflammatory responses and the specific pathways involved, particularly in macrophages where noc4l has been shown to inhibit TLR4 endocytosis and TRIF pathway activation .

How does noc4l regulate insulin sensitivity and glucose metabolism?

Noc4l has been identified as a significant regulator of glucose metabolism through several molecular mechanisms:

  • TLR4/TRIF pathway inhibition: By interacting with TLR4 and inhibiting its endocytosis, noc4l blocks TRIF pathway activation, which otherwise would contribute to insulin resistance

  • Macrophage polarization: Noc4l deficiency promotes pro-inflammatory M1-like macrophage polarization, which impairs insulin signaling

  • AKT signaling regulation: Macrophage-specific deletion of Noc4l attenuates insulin-stimulated AKT (Ser473) phosphorylation in white adipose tissue and muscle

  • Systemic metabolic effects: Noc4l expression negatively correlates with glucose levels and positively correlates with insulin sensitivity

Research has demonstrated that macrophage-specific knockout of Noc4l (Noc4l LKO) in mice leads to significant metabolic abnormalities, particularly when challenged with a high-fat diet. Conversely, Noc4l overexpression improves glucose metabolism. These findings suggest noc4l could be a potential therapeutic target for insulin resistance and metabolic disorders .

What is the relationship between noc4l expression and disease states?

Emerging research has identified associations between noc4l expression and several pathological conditions:

Disease/ConditionNoc4l Expression PatternPotential Mechanism
ObesityDecreased in obese humans and miceUnknown, possibly related to chronic inflammation
Insulin ResistanceNegatively correlated with glucose levelsInhibition of TLR4/TRIF pathway activation
Inflammatory DisordersPotentially protective when expressedSuppression of pro-inflammatory signaling
Metabolic SyndromeDecreased expression associated with metabolic abnormalitiesRegulation of macrophage polarization

While initially characterized for its role in ribosome biogenesis, noc4l's unexpected functions in inflammatory and metabolic pathways suggest it may have broader implications for various human diseases characterized by chronic inflammation and metabolic dysregulation .

How can advanced genetic engineering approaches be used to modulate noc4l function?

Advanced genetic engineering strategies to manipulate noc4l expression and function include:

  • CRISPR/Cas9 gene editing: For generating precise knockouts or introducing specific mutations

  • Conditional knockout systems: Cre-loxP for tissue-specific and inducible noc4l deletion

  • AAV-delivered shRNA: For post-developmental knockdown in specific tissues

  • Lentiviral overexpression: As demonstrated in studies where noc4l overexpression improved glucose metabolism

  • CRISPR activation/inhibition (CRISPRa/CRISPRi): For modulating endogenous noc4l expression without altering the genome

  • Domain-specific mutations: To dissect the functional importance of specific protein regions

  • Humanized zebrafish models: Replacing zebrafish noc4l with human variants to study conservation and species differences

These approaches allow researchers to precisely manipulate noc4l in various experimental contexts, from cell culture to whole organisms, enabling detailed functional studies and potential therapeutic development .

How does noc4l function differ between its traditional role in ribosome biosynthesis and newly discovered roles?

The evolutionary divergence of noc4l function represents an intriguing area of research:

  • Traditional role (yeast): NOC4 mediates 40S ribosomal subunit synthesis

  • Novel functions (vertebrates):

    • Macrophage-specific expression pattern

    • Interaction with TLR4 and inhibition of endocytosis

    • Regulation of inflammatory signaling pathways

    • Modulation of insulin sensitivity and glucose metabolism

This functional divergence suggests noc4l may have evolved additional regulatory roles in vertebrates beyond its ancestral function in ribosome biogenesis. Research questions remain about whether these functions are completely independent or whether there are mechanistic connections between ribosome biosynthesis and inflammatory regulation that have yet to be discovered .

What experimental approaches can resolve contradictory findings in noc4l research?

When addressing conflicting results in noc4l research, consider implementing:

  • Standardized model systems: Ensure consistent genetic backgrounds and environmental conditions

  • Comprehensive phenotyping: Examine multiple parameters beyond the primary focus

  • Tissue-specific analysis: Noc4l may have distinct functions in different cell types

  • Temporal considerations: Developmental timing of noc4l manipulation may yield different outcomes

  • Dose-dependent effects: Both overexpression and complete knockout may not reflect physiological regulation

  • Multi-omics approaches: Integrate transcriptomics, proteomics, and metabolomics data

  • Mechanistic validation: Confirm proposed mechanisms through multiple independent techniques

By applying these methodological approaches, researchers can better understand context-dependent functions of noc4l and resolve apparently contradictory findings that may result from different experimental conditions or biological contexts .

What are the most promising future research directions for noc4l?

Based on current knowledge, several high-priority research directions emerge:

  • Structural biology: Determine the three-dimensional structure of noc4l to understand its interaction interfaces

  • Systems biology: Map the complete noc4l interactome in different cell types and conditions

  • Translational research: Explore the therapeutic potential of noc4l modulation for metabolic diseases

  • Evolutionary biology: Investigate how noc4l function has diverged across species

  • Immunometabolism: Further characterize how noc4l links inflammatory pathways to metabolic regulation

  • Development of specific modulators: Design small molecules or peptides that can enhance or inhibit specific noc4l functions

  • Clinical correlations: Examine noc4l expression and polymorphisms in human patient cohorts with inflammatory and metabolic diseases

These research directions could significantly advance our understanding of noc4l biology and potentially lead to novel therapeutic approaches for conditions characterized by dysregulated inflammation and metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.